Comparing CA265_RS19710 FitnessBrowser__Pedo557:CA265_RS19710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
29% identity, 100% coverage: 1:493/494 of query aligns to 1:482/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
29% identity, 100% coverage: 1:493/494 of query aligns to 1:474/476 of 2itmA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
27% identity, 80% coverage: 5:399/494 of query aligns to 8:421/506 of 3i8bA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 98% coverage: 2:486/494 of query aligns to 3:478/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 98% coverage: 2:486/494 of query aligns to 4:480/492 of 3ll3A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 98% coverage: 2:485/494 of query aligns to 4:477/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 98% coverage: 2:485/494 of query aligns to 4:477/478 of 5ya1A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
23% identity, 100% coverage: 3:494/494 of query aligns to 1:479/485 of 6k76A
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
23% identity, 98% coverage: 2:483/494 of query aligns to 2:524/546 of 3qdkA
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
23% identity, 98% coverage: 2:485/494 of query aligns to 6:489/506 of O34153
3h3nX Glycerol kinase h232r with glycerol (see paper)
23% identity, 98% coverage: 2:485/494 of query aligns to 5:488/501 of 3h3nX
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
24% identity, 96% coverage: 3:476/494 of query aligns to 10:480/507 of 2w41B
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
24% identity, 96% coverage: 3:476/494 of query aligns to 4:474/501 of 2w40A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 98% coverage: 2:485/494 of query aligns to 6:488/501 of O34154
Sites not aligning to the query:
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
23% identity, 80% coverage: 1:395/494 of query aligns to 4:397/498 of 3kzbA
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
22% identity, 99% coverage: 2:491/494 of query aligns to 4:494/497 of O86033
6zq4F Crystal structure of chaetomium thermophilum glycerol kinase in complex with substrate in p1 space group (see paper)
27% identity, 86% coverage: 6:431/494 of query aligns to 7:441/512 of 6zq4F
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
22% identity, 95% coverage: 3:472/494 of query aligns to 5:470/495 of 6udeB
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
22% identity, 99% coverage: 2:488/494 of query aligns to 4:490/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
22% identity, 99% coverage: 2:488/494 of query aligns to 5:491/499 of 3ge1A
>CA265_RS19710 FitnessBrowser__Pedo557:CA265_RS19710
MYLLGIDLGTSSIKVAVVDATTQRNVASAQYPEEETAIKSLQSGWAEQSPNDWWQNVQQA
ILKLNSTGLFDPKEIKAIGIAYQMHGLVVVDKNQEVLRDSIIWCDSRAVELGNGAFEAIG
NEKSLKHLLNSPGNFTASKLAWVKANEPDIYSRIDKIMLPGDFIAMKLTGEITTSISALS
EGIFWDFENHEISKDVMNYYSISVDLIPTIKPLFSEHGYLKTAIAQALGLTTGIPVAYKS
GDQPNNALSLNVLKPGEVAATAGTSGVIYGISDGLTYDKQSRVNTFAHVTFTEEQKHTGV
LLCINGTGSMYRWAKHNFAPQSTYAELNNLASKAPIGSNGLKVLPFGNGAERMLNNKYTG
AQLLGIDLNRHNPSDIFRAVQEGIAFSFRYGLDIMRENGMKPKVIRAGRANLFLSDVFAQ
TFVDVTGIPVELYENDGSVGAGIGAGIGAGIFKSAEEAFSNHEVIKTLMPQHPAAYEPIY
QDWKEILEKQLAMG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory