SitesBLAST
Comparing CA265_RS19715 FitnessBrowser__Pedo557:CA265_RS19715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xkmA Crystal structure of xylose isomerase from an human intestinal tract microbe bacteroides thetaiotaomicron
65% identity, 98% coverage: 10:443/443 of query aligns to 2:435/435 of 4xkmA
- active site: F23 (= F31), E29 (≠ N37), H100 (= H108), D103 (= D111), W138 (= W146), E231 (= E239), K233 (= K241), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
- binding manganese (ii) ion: E231 (= E239), E267 (= E275), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
5nhcA Crystal structure of xylose isomerase from piromyces e2 in complex with two co2+ ions and xylulose (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nhcA
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding cobalt (ii) ion: E232 (= E239), E268 (= E275), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding 4-hydroxyproline: G290 (= G297), L292 (= L299), G328 (= G335), G330 (= G337), V332 (≠ Q339)
- binding d-xylulose: W49 (= W56), H101 (= H108), W188 (= W195), E232 (= E239), E268 (= E275), H271 (= H278), D339 (= D346)
5nhaA Crystal structure of xylose isomerase from piromyces sp. E2 in complex with two mn2+ ions and sorbitol (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nhaA
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding manganese (ii) ion: E232 (= E239), E268 (= E275), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding sorbitol: W49 (= W56), H101 (= H108), W188 (= W195), E232 (= E239), D339 (= D346)
5nh9A Crystal structure of xylose isomerase from piromyces e2 in complex with two mn2+ ions and xylose (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nh9A
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding manganese (ii) ion: E232 (= E239), E268 (= E275), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding D-xylose: W49 (= W56), H101 (= H108), W188 (= W195), E232 (= E239), E268 (= E275), H271 (= H278), D339 (= D346)
- binding beta-D-xylopyranose: G63 (≠ A70), K65 (≠ H72), S66 (≠ I73), K203 (= K210), K206 (≠ Q213), H257 (≠ Y264), D288 (= D295), A289 (≠ N296)
5nh7A Crystal structure of xylose isomerase from piromyces e2 in complex with two mg2+ ions and xylose (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nh7A
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding magnesium ion: E232 (= E239), E268 (= E275), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding D-xylose: W49 (= W56), H101 (= H108), W188 (= W195), E232 (= E239), E268 (= E275), H271 (= H278), D339 (= D346)
- binding beta-D-xylopyranose: G63 (≠ A70), K65 (≠ H72), S66 (≠ I73)
- binding alpha-D-xylopyranose: P21 (= P28), D40 (≠ E47), Y97 (= Y104), K136 (= K143), E350 (≠ K357)
5nh6A Crystal structure of xylose isomerase from piromyces e2 complexed with one mg2+ ion and xylitol (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nh6A
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding magnesium ion: E232 (= E239), E268 (= E275), D296 (= D303), D339 (= D346)
- binding Xylitol: W49 (= W56), H101 (= H108), W188 (= W195), E232 (= E239), E268 (= E275), H271 (= H278), D339 (= D346)
5nh5A Crystal structure of native xylose isomerase from piromyces e2 (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nh5A
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding calcium ion: E232 (= E239), E268 (= E275), D296 (= D303), D339 (= D346)
- binding fe (ii) ion: E232 (= E239), E268 (= E275), D296 (= D303), D339 (= D346)
- binding magnesium ion: E232 (= E239), E268 (= E275), D296 (= D303), D339 (= D346)
5nh4A Crystal structure of xylose isomerase from piromyces e2 in complex with one mg2+ ions and glycerol (see paper)
61% identity, 98% coverage: 8:442/443 of query aligns to 1:435/436 of 5nh4A
- active site: H101 (= H108), D104 (= D111), W139 (= W146), E232 (= E239), K234 (= K241), E268 (= E275), H271 (= H278), D296 (= D303), D307 (= D314), D309 (= D316), D339 (= D346)
- binding magnesium ion: E232 (= E239), E268 (= E275), D296 (= D303), D339 (= D346)
5yn3A Crystal structure of xylose isomerase from piromyces sp. E2 (see paper)
61% identity, 98% coverage: 10:442/443 of query aligns to 2:434/435 of 5yn3A
- active site: H100 (= H108), D103 (= D111), W138 (= W146), E231 (= E239), K233 (= K241), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
- binding glycerol: H100 (= H108), W187 (= W195), E231 (= E239), D295 (= D303)
- binding manganese (ii) ion: E231 (= E239), E267 (= E275), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
P00944 Xylose isomerase; D-xylulose keto-isomerase; EC 5.3.1.5 from Escherichia coli (strain K12) (see paper)
51% identity, 98% coverage: 11:443/443 of query aligns to 4:437/440 of P00944
- H101 (= H108) active site
1a0cA Xylose isomerase from thermoanaerobacterium thermosulfurigenes
50% identity, 98% coverage: 10:443/443 of query aligns to 2:435/437 of 1a0cA
- active site: H100 (= H108), D103 (= D111), W138 (= W146), E231 (= E239), K233 (= K241), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
- binding cobalt (ii) ion: E231 (= E239), E267 (= E275), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
1a0eA Xylose isomerase from thermotoga neapolitana
51% identity, 98% coverage: 10:443/443 of query aligns to 2:435/443 of 1a0eA
- active site: H100 (= H108), D103 (= D111), W138 (= W146), E231 (= E239), K233 (= K241), E267 (= E275), H270 (= H278), D295 (= D303), D306 (= D314), D308 (= D316), D338 (= D346)
- binding cobalt (ii) ion: E231 (= E239), E267 (= E275), E267 (= E275), H270 (= H278), D295 (= D303), D308 (= D316), D338 (= D346)
1a0dA Xylose isomerase from bacillus stearothermophilus
50% identity, 98% coverage: 11:443/443 of query aligns to 2:433/437 of 1a0dA
- active site: H98 (= H108), D101 (= D111), W136 (= W146), E229 (= E239), K231 (= K241), E265 (= E275), H268 (= H278), D293 (= D303), D304 (= D314), D306 (= D316), D336 (= D346)
- binding manganese (ii) ion: E229 (= E239), E265 (= E275), E265 (= E275), H268 (= H278), D293 (= D303), D304 (= D314), D306 (= D316), D336 (= D346)
6intA Xylose isomerase from paenibacillus sp. R4 (see paper)
49% identity, 98% coverage: 11:443/443 of query aligns to 1:410/413 of 6intA
- active site: H74 (= H108), D77 (= D111), W112 (= W146), E205 (= E239), K207 (= K241), E241 (= E275), H244 (= H278), D269 (= D303), D280 (= D314), D282 (= D316), D313 (= D346)
- binding calcium ion: G166 (= G200), E178 (= E212), E205 (= E239), E241 (= E275), E241 (= E275), H244 (= H278), D269 (= D303), D280 (= D314), D282 (= D316), D313 (= D346)
1xiiA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
28% identity, 60% coverage: 50:317/443 of query aligns to 8:254/385 of 1xiiA
- active site: H52 (= H108), D55 (= D111), M86 (≠ W146), E179 (= E239), K181 (= K241), E215 (= E275), H218 (= H278), D243 (= D303), D253 (= D316)
- binding manganese (ii) ion: E179 (= E239), E215 (= E275), E215 (= E275), H218 (= H278), D243 (= D303), D253 (= D316)
- binding d-xylulose: W14 (= W56), H52 (= H108), W135 (= W195), E179 (= E239), H218 (= H278)
Sites not aligning to the query:
1xihA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
28% identity, 60% coverage: 50:317/443 of query aligns to 8:254/385 of 1xihA
- active site: H52 (= H108), D55 (= D111), M86 (≠ W146), E179 (= E239), K181 (= K241), E215 (= E275), H218 (= H278), D243 (= D303), D253 (= D316)
- binding manganese (ii) ion: E179 (= E239), E215 (= E275), D243 (= D303)
- binding sorbitol: H52 (= H108), T88 (= T148), V133 (= V193), W135 (= W195), E179 (= E239), K181 (= K241), E215 (= E275), H218 (= H278)
Sites not aligning to the query:
1xicA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
28% identity, 60% coverage: 50:317/443 of query aligns to 8:254/385 of 1xicA
- active site: H52 (= H108), D55 (= D111), M86 (≠ W146), E179 (= E239), K181 (= K241), E215 (= E275), H218 (= H278), D243 (= D303), D253 (= D316)
- binding manganese (ii) ion: E179 (= E239), E215 (= E275), E215 (= E275), H218 (= H278), D243 (= D303), D253 (= D316)
- binding D-xylose: W14 (= W56), H52 (= H108), W135 (= W195), E179 (= E239), H218 (= H278)
Sites not aligning to the query:
9xiaA X-ray analysis of d-xylose isomerase at 1.9 angstroms: native enzyme in complex with substrate and with a mechanism-designed inactivator (see paper)
28% identity, 60% coverage: 50:317/443 of query aligns to 10:256/387 of 9xiaA
- active site: H54 (= H108), D57 (= D111), M88 (≠ W146), E181 (= E239), K183 (= K241), E217 (= E275), H220 (= H278), D245 (= D303), D255 (= D316)
- binding 3-deoxy-3-methyl-beta-D-fructofuranose: W16 (= W56), H54 (= H108), M88 (≠ W146), T90 (= T148), V135 (= V193), W137 (= W195), E181 (= E239), D245 (= D303)
- binding manganese (ii) ion: E181 (= E239), E217 (= E275), E217 (= E275), H220 (= H278), D245 (= D303), D255 (= D316)
Sites not aligning to the query:
1xieA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
28% identity, 60% coverage: 50:317/443 of query aligns to 10:256/387 of 1xieA
- active site: H54 (= H108), D57 (= D111), M88 (≠ W146), E181 (= E239), K183 (= K241), E217 (= E275), H220 (= H278), D245 (= D303), D255 (= D316)
- binding 1,5-anhydro-D-glucitol: H54 (= H108), W137 (= W195), E181 (= E239)
- binding manganese (ii) ion: E181 (= E239), E217 (= E275), E217 (= E275), H220 (= H278), D245 (= D303), D255 (= D316)
Sites not aligning to the query:
1xidA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
28% identity, 60% coverage: 50:317/443 of query aligns to 10:256/387 of 1xidA
- active site: H54 (= H108), D57 (= D111), M88 (≠ W146), E181 (= E239), K183 (= K241), E217 (= E275), H220 (= H278), D245 (= D303), D255 (= D316)
- binding ascorbic acid: W16 (= W56), H54 (= H108), W137 (= W195), E181 (= E239)
- binding manganese (ii) ion: E181 (= E239), E217 (= E275), E217 (= E275), H220 (= H278), D245 (= D303), D255 (= D316)
Sites not aligning to the query:
Query Sequence
>CA265_RS19715 FitnessBrowser__Pedo557:CA265_RS19715
MTKVVTGATEFFKGIEQIKFEGLGSDNPLAFRWYDANKVVAGKTMNEHFKFACAYWHSFN
GNGADPFGGATHIFPWDEKKDAVERAKDKMDAAFEFITKMQIPYYCFHDVDVVDYSDDIA
ENERRLQALVEYAKQKQADSGVKLLWGTANLFSHRRYMNGASTNPDFHVLAHGAAQVKAA
LDATIALGGENYVFWGGREGYMSLLNTNMKREQEHLAKFLHTAKDYARKQGFKGTFFIEP
KPCEPSKHQYDYDAATVKGFLQQYDLLADFKLNLEVNHATLAGHTFQHELQVAVDNGLLG
SIDANRGDYQNGWDTDQFPNDINELTETMLIILEGGGLQGGGVNFDAKIRRNSTDPKDLF
YAHIGGMDIFARALITADAILQKSDYKKIRTERYASFDSGKGAEFEQGKLSLEDLRNYAA
ENGEPAVLSGKQEYLENLINRYI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory