Comparing CA265_RS19735 FitnessBrowser__Pedo557:CA265_RS19735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
39% identity, 93% coverage: 15:212/212 of query aligns to 13:207/209 of 7ev5A
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
35% identity, 98% coverage: 5:212/212 of query aligns to 4:208/210 of 2xf4A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
39% identity, 97% coverage: 8:212/212 of query aligns to 7:200/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
39% identity, 97% coverage: 8:212/212 of query aligns to 5:198/198 of 2zziA
6sg9FL uS3m (see paper)
28% identity, 94% coverage: 10:209/212 of query aligns to 60:294/320 of 6sg9FL
Sites not aligning to the query:
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
30% identity, 100% coverage: 2:212/212 of query aligns to 2:200/202 of 7l0bA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
27% identity, 99% coverage: 1:210/212 of query aligns to 3:194/350 of 5ve5A
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
28% identity, 92% coverage: 16:210/212 of query aligns to 37:213/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
28% identity, 92% coverage: 16:210/212 of query aligns to 21:197/237 of 4chlB
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
29% identity, 92% coverage: 16:210/212 of query aligns to 15:188/225 of 4ysbA
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
29% identity, 95% coverage: 10:210/212 of query aligns to 11:201/244 of 2gcuA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 10:210/212 of query aligns to 60:250/294 of Q9C8L4
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
26% identity, 97% coverage: 4:209/212 of query aligns to 5:223/473 of 3tp9A
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
28% identity, 98% coverage: 5:212/212 of query aligns to 8:213/336 of 3r2uB
Sites not aligning to the query:
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
27% identity, 85% coverage: 17:196/212 of query aligns to 15:169/254 of 2q42A
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
25% identity, 91% coverage: 4:196/212 of query aligns to 9:212/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
25% identity, 91% coverage: 4:196/212 of query aligns to 9:212/294 of 4yskA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 85% coverage: 17:196/212 of query aligns to 85:239/324 of Q9SID3
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
26% identity, 92% coverage: 3:196/212 of query aligns to 48:221/308 of Q16775
Sites not aligning to the query:
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
26% identity, 84% coverage: 18:196/212 of query aligns to 17:173/260 of 1qh5B
Sites not aligning to the query:
>CA265_RS19735 FitnessBrowser__Pedo557:CA265_RS19735
MITIKTFTFNAYSENTYVLYDETKECVIIDPGMYEGFEQNELAAFIKNEGLKPVLLLNTH
CHLDHVFGNKFVFETYGLKPQFHQGELPILNAVPGYAPSMGFTRYAISPLPDTFLPETGT
VSFGNSTLTLIFAPGHSPAHLCFYSAADHILIGGDVLFYGSIGRTDLPGGNHQQLIQNIS
DKLFVLPDETKVYPGHGPATSIGFEKQHNPFF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory