Comparing CA265_RS19920 FitnessBrowser__Pedo557:CA265_RS19920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 41% coverage: 12:218/507 of query aligns to 40:255/583 of Q9Y7Q9
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 36% coverage: 65:245/507 of query aligns to 187:357/616 of P36035
Sites not aligning to the query:
8fvzA Pipt y150a
28% identity, 38% coverage: 12:206/507 of query aligns to 4:201/433 of 8fvzA
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 45% coverage: 11:240/507 of query aligns to 45:287/572 of O42885
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 43% coverage: 26:243/507 of query aligns to 56:247/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 37% coverage: 60:249/507 of query aligns to 112:316/587 of P25297
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 43% coverage: 11:226/507 of query aligns to 43:268/559 of Q09852
Sites not aligning to the query:
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 31% coverage: 56:214/507 of query aligns to 140:283/592 of P38695
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
29% identity, 33% coverage: 69:235/507 of query aligns to 58:208/446 of A0A0H2VG78
Sites not aligning to the query:
>CA265_RS19920 FitnessBrowser__Pedo557:CA265_RS19920
MSDTLPRNNIFKVIGASSLGTLIEWYDFYIFGSLAVIIGHQLFPEDAGASALINTLAIFA
AGFIVRPFGALVFGRLGDLIGRKYTFLLTLVLMGGSTFFIGLIPSYKSIGYAAPILVLIL
RLIQGLALGGEYGGAATYVAEHAPKNKRGFFTSWIQTTATLGLFLSLGIIVITKNILGAE
TFGDWGWRIPFLLSIVLVVVSIYIRMKMHESPMFSKLKAEGNVSKNPLKESFNNKANFKM
VLLALFGATMGQGVIWYTGQFYAQSFLENTCKLDFNDSRYILLWGIAFATPFFVIFGAWS
DKVGRKWIMLSGMLLGILFYRPIYQIFLDDTDYTKIEQTDILSARPAPVTSVLIANSTDS
LRTVSTKVMLKNGASFNKVQTDTVSATKGILLGKEVVKDKILPTPVFWKFVGLIFFQILL
VTMVYGPIAAFLVELFPTKIRYTSMSLPYHIGNGVFGGLVPFIATLIASFSGSTPLSGLW
YPIGIAALSLVIGAIYLSNKRDENIND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory