Comparing CA265_RS20545 FitnessBrowser__Pedo557:CA265_RS20545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
37% identity, 91% coverage: 32:415/420 of query aligns to 15:394/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
37% identity, 91% coverage: 32:415/420 of query aligns to 15:394/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
37% identity, 91% coverage: 32:415/420 of query aligns to 15:394/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
37% identity, 91% coverage: 32:415/420 of query aligns to 15:394/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
37% identity, 91% coverage: 32:415/420 of query aligns to 15:394/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
37% identity, 91% coverage: 32:415/420 of query aligns to 15:394/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
38% identity, 91% coverage: 32:412/420 of query aligns to 15:391/392 of 3a2bA
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
40% identity, 83% coverage: 66:413/420 of query aligns to 44:394/398 of 7poaA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
31% identity, 97% coverage: 9:416/420 of query aligns to 228:635/653 of Q5W264
Sites not aligning to the query:
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
35% identity, 83% coverage: 66:415/420 of query aligns to 44:398/400 of 7v58B
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
35% identity, 82% coverage: 69:413/420 of query aligns to 45:394/398 of P0AB77
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
35% identity, 82% coverage: 69:413/420 of query aligns to 48:397/401 of 1fc4A
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
34% identity, 83% coverage: 64:413/420 of query aligns to 38:393/396 of 3tqxA
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
33% identity, 91% coverage: 30:411/420 of query aligns to 33:413/419 of Q0P5L8
Sites not aligning to the query:
7u7hA Cysteate acyl-acp transferase from alistipes finegoldii (see paper)
33% identity, 84% coverage: 66:416/420 of query aligns to 45:405/423 of 7u7hA
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
34% identity, 83% coverage: 66:415/420 of query aligns to 44:398/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
34% identity, 83% coverage: 66:415/420 of query aligns to 44:398/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
34% identity, 83% coverage: 66:415/420 of query aligns to 44:398/399 of 7bxqA
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
33% identity, 81% coverage: 66:406/420 of query aligns to 44:388/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
33% identity, 81% coverage: 66:406/420 of query aligns to 44:388/398 of 2w8jA
Sites not aligning to the query:
>CA265_RS20545 FitnessBrowser__Pedo557:CA265_RS20545
MDINFEKASFKDFENIEGMDAYQRARYFAEYLEYLKSRGHLNYRMETMSGCGPEVELDIA
GYGGKKKYVSLVSNDYLGFTQHDLVKKAAIDGIKKFGTGAGASPAIGGHFSFHEMLEQKI
AAFFGREAAITYTTGYTANSASLLCLLKKEDMAILDMAVHASVYEGCMNTNIKMFLHNNM
DALERALRESRDTHRTRIVVVDGVYSQDGDLAPLDKILELTHFYGAYLMVDDAHGIGVLG
RTGRGLIQDYDLLDKVDIISGTFSKTFGHVGGYVVASAELIQFLKYQSRQHLFSVTASPA
SMAILKAIDLIDEEPEWQDMLWENITYFQDGLKGLGLDIGTTASGIVPVKIRDIPKTLEV
GRLLLRAGVYANPIMYPAVAKKDSRIRMSLMATHTRPQLDKVLNAFSDIAKKLQLGSQYQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory