Comparing CA265_RS20850 FitnessBrowser__Pedo557:CA265_RS20850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
34% identity, 97% coverage: 8:409/415 of query aligns to 7:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
34% identity, 97% coverage: 8:409/415 of query aligns to 7:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
28% identity, 96% coverage: 10:407/415 of query aligns to 15:407/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
21% identity, 63% coverage: 2:261/415 of query aligns to 13:262/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
21% identity, 63% coverage: 2:261/415 of query aligns to 14:263/456 of 5j7iB
Sites not aligning to the query:
>CA265_RS20850 FitnessBrowser__Pedo557:CA265_RS20850
MDYKQYFEKAQQASRTLISLSKETTDAVLTALAAALVANTELILAENGKDLAKMPIEDPK
YDRLKLSRERIADIANDLKNVAGLSSPLGKIISDKTLENQLHIQKVSVPLGVVGVIYEAR
PNVTADVFSLCFKTGNVAVLKGGSDAEFSNLAIAKVIHGVLDKNGINADILTLLPAERAA
TEALLNARGFVDVLIPRGSQSLINYVRENSKIPVIETGAGIVHTYFDETGDLEKGKAIIF
NAKTRRVSVCNSLDCVLINQNRLTDLPALLSPLADGNVELYADEKSYEALKVSYPAQLLN
QASPEHFGTEFLSLKLAVKIVADLTEALNHIADYSSKHSEAIISEDADNIAQFLNEVDAA
AVYANASTGFTDGAQFGLGAEIGISTQKLHARGPMGLEELTSYKWVVRGDGQVRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory