Comparing CA265_RS20855 FitnessBrowser__Pedo557:CA265_RS20855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
33% identity, 99% coverage: 6:359/359 of query aligns to 3:357/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
32% identity, 99% coverage: 6:359/359 of query aligns to 5:359/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
30% identity, 99% coverage: 6:359/359 of query aligns to 3:317/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
30% identity, 97% coverage: 6:354/359 of query aligns to 3:310/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
38% identity, 49% coverage: 6:180/359 of query aligns to 1:171/241 of 2akoA
Sites not aligning to the query:
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
32% identity, 70% coverage: 6:255/359 of query aligns to 13:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
31% identity, 70% coverage: 6:255/359 of query aligns to 13:234/236 of 7f5xA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
28% identity, 50% coverage: 7:186/359 of query aligns to 2:156/225 of Q8U122
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
28% identity, 51% coverage: 5:186/359 of query aligns to 2:158/219 of 2ji5A
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
28% identity, 50% coverage: 7:186/359 of query aligns to 3:157/226 of 2bmuB
Sites not aligning to the query:
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
32% identity, 25% coverage: 93:180/359 of query aligns to 115:201/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
32% identity, 25% coverage: 93:180/359 of query aligns to 115:201/269 of O50147
Sites not aligning to the query:
8u0mA Isopentenyl phosphate kinase (see paper)
27% identity, 38% coverage: 120:255/359 of query aligns to 118:243/247 of 8u0mA
Sites not aligning to the query:
>CA265_RS20855 FitnessBrowser__Pedo557:CA265_RS20855
MKLGYKKIVVKVGSNVITQANGLPDEGRIKHLVNQLADIKKQGIEVILVSSGAVASGRSL
IKVSEKQDAVTTRQLLAAIGQVKLINTYANFFAAHAIQCAQVLVTKEDFRDRAHYLNMKN
CLQILLQNEVIPVVNENDVVSVTELMFTDNDELAGLIASMLNADALIILSNVNGIYNGDP
KVEGSAVIEEINGSVANLASFIQTGKSQFGRGGMITKSTMAQKVAKLGITVHIANGTKDN
VLTSLLNNELVHTRFVPEKSKSGKKKWIAHSETAATGVVKLNDGAKTVLTSSKATSLLPV
GIIEIQTDFLKGDIIKIVDEKNNLIGLGIAEYGSDKARERIGQKKQKALVHYDYFYSAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory