Comparing CA265_RS21455 FitnessBrowser__Pedo557:CA265_RS21455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
24% identity, 83% coverage: 52:320/326 of query aligns to 23:283/293 of 3pzlB
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
29% identity, 46% coverage: 48:198/326 of query aligns to 14:161/298 of 4mynA
Sites not aligning to the query:
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
25% identity, 41% coverage: 56:189/326 of query aligns to 5:136/298 of 5cevA
Sites not aligning to the query:
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
25% identity, 41% coverage: 56:189/326 of query aligns to 5:136/298 of 4cevA
Sites not aligning to the query:
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
25% identity, 41% coverage: 56:189/326 of query aligns to 5:136/298 of 3cevA
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
25% identity, 41% coverage: 56:189/326 of query aligns to 5:136/298 of 2cevB
Sites not aligning to the query:
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
25% identity, 41% coverage: 56:189/326 of query aligns to 6:137/299 of 1cevA
Sites not aligning to the query:
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
25% identity, 41% coverage: 56:189/326 of query aligns to 6:137/299 of P53608
Sites not aligning to the query:
6nbkA Crystal structure of arginase from bacillus cereus
26% identity, 50% coverage: 56:218/326 of query aligns to 5:161/289 of 6nbkA
Sites not aligning to the query:
5hjaA Crystal structure of leishmania mexicana arginase in complex with inhibitor abhdp (see paper)
33% identity, 21% coverage: 123:189/326 of query aligns to 75:140/303 of 5hjaA
Sites not aligning to the query:
4iu5A Crystal structure of leishmania mexicana arginase in complex with catalytic product l-ornithine (see paper)
33% identity, 21% coverage: 123:189/326 of query aligns to 75:140/310 of 4iu5A
Sites not aligning to the query:
4iu4A Crystal structure of leishmania mexicana arginase in complex with inhibitor bec (see paper)
33% identity, 21% coverage: 123:189/326 of query aligns to 75:140/310 of 4iu4A
Sites not aligning to the query:
4iu1A Crystal structure of leishmania mexicana arginase in complex with inhibitor nor-noha (see paper)
33% identity, 21% coverage: 123:189/326 of query aligns to 75:140/310 of 4iu1A
Sites not aligning to the query:
4iu0A Crystal structure of leishmania mexicana arginase in complex with inhibitor abh (see paper)
33% identity, 21% coverage: 123:189/326 of query aligns to 75:140/310 of 4iu0A
Sites not aligning to the query:
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
32% identity, 39% coverage: 63:189/326 of query aligns to 6:131/292 of 6nfpA
Sites not aligning to the query:
>CA265_RS21455 FitnessBrowser__Pedo557:CA265_RS21455
MDNLKIYSQGDIDHLIITRDGETKLGERVNVYSGDSSSTAGISVEGLKASSAKFVLLGIP
EDIGVRANLGLAGAASMWKPGLVAFLNTQSNRFLSGEEVLVLGHFEIDEPEDSSLKGLRN
KVAQIDDLVYPVIEKIVATGKIPVVIGGGHNNAYPMIKGTSLAHKRPITVLNVDAHADLR
ELEGRHSGNGFSYALKENYLNNYLMYGLHQNYNNEAILNQIDTNPKLKAVFFDDILTGAD
FTNLVNEIGSVAGLEIDLDCVQNVLSSAETPSGFAVNDIRKLILTSAKKFSYLHLSEGAT
RMLDGRVSKLTSKLVAYLVSDFIKAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory