SitesBLAST
Comparing CA265_RS21610 FitnessBrowser__Pedo557:CA265_RS21610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
49% identity, 99% coverage: 3:497/502 of query aligns to 1:498/502 of 6brlA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of 2cv2A
- active site: K246 (= K261)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R8), A7 (= A10), S9 (= S12), G17 (= G20), I21 (≠ T24), E41 (= E44), Y187 (= Y199), R205 (= R217), A206 (≠ G218), E208 (= E220), W209 (= W221), L235 (= L249), L236 (≠ I250)
- binding : S9 (= S12), T43 (= T46), D44 (= D47), R47 (= R50), V145 (= V157), R163 (= R175), Y168 (≠ F180), E172 (≠ L184), V177 (= V189), K180 (= K192), S181 (≠ A193), Y187 (= Y199), E207 (= E219), E208 (= E220), W209 (= W221), V211 (≠ P223), R237 (≠ L251), K241 (≠ H256), L272 (= L304), M273 (≠ L305), G274 (= G306), E282 (= E314), S299 (= S331), P303 (≠ A335), V304 (≠ K336), K309 (= K341), W312 (= W344), R319 (≠ K351), P357 (≠ D388), R358 (= R389), R417 (≠ K447), Q432 (≠ L462), R435 (= R465), L442 (≠ K472), E443 (≠ F473), T444 (≠ G474), G446 (= G476), L447 (≠ V477), F448 (= F478)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of 2cv1A
- active site: K246 (= K261)
- binding adenosine-5'-triphosphate: P8 (= P11), S9 (= S12), G17 (= G20), T18 (≠ G21), I21 (≠ T24), R47 (= R50), A206 (≠ G218), W209 (= W221), L235 (= L249), L236 (≠ I250)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R8), A7 (= A10), E41 (= E44), Y187 (= Y199), R205 (= R217), W209 (= W221)
- binding : S9 (= S12), E41 (= E44), T43 (= T46), D44 (= D47), R47 (= R50), V145 (= V157), R163 (= R175), V166 (= V178), E172 (≠ L184), V177 (= V189), K180 (= K192), S181 (≠ A193), Y187 (= Y199), E207 (= E219), E208 (= E220), W209 (= W221), V211 (≠ P223), R237 (≠ L251), K241 (≠ H256), K243 (= K258), M273 (≠ L305), G274 (= G306), S276 (≠ N308), E282 (= E314), S299 (= S331), P303 (≠ A335), V304 (≠ K336), K309 (= K341), W312 (= W344), R319 (≠ K351), P357 (≠ D388), R358 (= R389), R417 (≠ K447), L427 (≠ P457), Q432 (≠ L462), R435 (= R465), L442 (≠ K472), E443 (≠ F473), T444 (≠ G474), G446 (= G476), L447 (≠ V477), F448 (= F478)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l- glutamate (see paper)
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of 1n78A
- active site: K246 (= K261)
- binding glutamol-amp: R5 (= R8), A7 (= A10), P8 (= P11), S9 (= S12), G17 (= G20), T18 (≠ G21), I21 (≠ T24), E41 (= E44), Y187 (= Y199), N191 (≠ V203), R205 (= R217), A206 (≠ G218), E208 (= E220), W209 (= W221), L235 (= L249), L236 (≠ I250)
- binding : S9 (= S12), T43 (= T46), D44 (= D47), R47 (= R50), V145 (= V157), R163 (= R175), V166 (= V178), Y168 (≠ F180), E172 (≠ L184), V177 (= V189), K180 (= K192), S181 (≠ A193), Y187 (= Y199), E207 (= E219), E208 (= E220), W209 (= W221), L210 (= L222), V211 (≠ P223), R237 (≠ L251), K241 (≠ H256), M273 (≠ L305), G274 (= G306), E282 (= E314), R297 (= R329), P303 (≠ A335), V304 (≠ K336), K309 (= K341), W312 (= W344), R319 (≠ K351), P357 (≠ D388), R358 (= R389), R417 (≠ K447), L427 (≠ P457), Q432 (≠ L462), R435 (= R465), L442 (≠ K472), E443 (≠ F473), T444 (≠ G474), G446 (= G476), L447 (≠ V477), F448 (= F478)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of 1j09A
- active site: K246 (= K261)
- binding adenosine-5'-triphosphate: H15 (= H18), E208 (= E220), L235 (= L249), L236 (≠ I250), K243 (= K258), I244 (≠ L259), S245 (= S260), K246 (= K261), R247 (= R262)
- binding glutamic acid: R5 (= R8), A7 (= A10), S9 (= S12), E41 (= E44), Y187 (= Y199), N191 (≠ V203), R205 (= R217), W209 (= W221)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of P27000
- R358 (= R389) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
39% identity, 98% coverage: 5:498/502 of query aligns to 2:468/468 of 1g59A
- binding : D44 (= D47), R45 (≠ Q48), A46 (≠ N49), R47 (= R50), P109 (= P112), V145 (= V157), R163 (= R175), V166 (= V178), E172 (≠ L184), V177 (= V189), K180 (= K192), S181 (≠ A193), D182 (= D194), E207 (= E219), E208 (= E220), R237 (≠ L251), K241 (≠ H256), T242 (≠ G257), K243 (= K258), M273 (≠ L305), G274 (= G306), E282 (= E314), S299 (= S331), L300 (≠ K332), P303 (≠ A335), V304 (≠ K336), K309 (= K341), W312 (= W344), R319 (≠ K351), P357 (≠ D388), R358 (= R389), R417 (≠ K447), K426 (= K456), L427 (≠ P457), Q432 (≠ L462), R435 (= R465), L442 (≠ K472), E443 (≠ F473), T444 (≠ G474), P445 (= P475), G446 (= G476), L447 (≠ V477), F448 (= F478)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
36% identity, 98% coverage: 5:496/502 of query aligns to 2:478/485 of 4griB
- active site: S9 (= S12), K253 (= K261)
- binding glutamic acid: R5 (= R8), A7 (= A10), S9 (= S12), E41 (= E44), Y194 (= Y199), R212 (= R217), W216 (= W221)
- binding zinc ion: C105 (≠ A108), C107 (≠ D110), Y128 (≠ Q134), C132 (≠ S138)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
34% identity, 99% coverage: 5:501/502 of query aligns to 4:470/488 of 8vc5A
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 98% coverage: 4:497/502 of query aligns to 2:461/471 of P04805
- C98 (≠ A108) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ D110) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ I143) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ E145) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ E147) mutation to Q: No change in activity or in zinc content.
- H131 (≠ L149) mutation to Q: No change in activity or in zinc content.
- H132 (≠ L150) mutation to Q: No change in activity or in zinc content.
- C138 (≠ H156) mutation to S: No change in activity or in zinc content.
- S239 (= S260) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
32% identity, 98% coverage: 4:497/502 of query aligns to 2:461/468 of 8i9iA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
34% identity, 98% coverage: 5:497/502 of query aligns to 103:559/564 of 3al0C
- active site: S110 (= S12), K335 (= K261)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R8), A108 (= A10), P109 (= P11), G118 (= G20), T122 (= T24), E142 (= E44), Y276 (= Y199), R294 (= R217), G295 (= G218), D297 (≠ E220), H298 (≠ W221), L324 (= L249), I325 (= I250), L333 (= L259)
- binding : T144 (= T46), D145 (= D47), R148 (= R50), Y208 (≠ D110), P213 (= P123), K252 (≠ R175), M255 (≠ V178), I266 (≠ V189), K269 (= K192), S270 (≠ A193), Y276 (= Y199), D297 (≠ E220), H298 (≠ W221), L299 (= L222), S300 (≠ P223), N301 (≠ S224), K304 (≠ V227), R330 (≠ H256), P332 (≠ K258), G363 (= G306), W364 (= W307), R365 (≠ N308), E370 (= E314), S387 (= S331), K389 (≠ A333), V391 (≠ A335), I392 (≠ K336), K397 (= K341), W400 (= W344), R407 (≠ K351), E446 (≠ D388), K447 (≠ R389), Q453 (≠ D395), I457 (≠ Q399), R509 (≠ K447), K520 (≠ E459), Q524 (≠ P463), R527 (≠ I466), V535 (vs. gap), T536 (≠ G474), G538 (= G476), L539 (≠ V477)
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
36% identity, 94% coverage: 5:475/502 of query aligns to 2:454/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
36% identity, 94% coverage: 5:478/502 of query aligns to 3:458/485 of Q8DLI5
- R6 (= R8) binding
- Y192 (= Y199) binding
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
33% identity, 81% coverage: 3:407/502 of query aligns to 1:356/380 of 4g6zA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
30% identity, 51% coverage: 8:263/502 of query aligns to 19:243/308 of P27305
- E55 (= E44) binding
- Y182 (= Y199) binding
- R200 (= R217) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
30% identity, 51% coverage: 8:262/502 of query aligns to 7:230/290 of 4a91A
- active site: S11 (= S12), K229 (= K261)
- binding glutamic acid: R7 (= R8), A9 (= A10), S11 (= S12), E43 (= E44), Y170 (= Y199), R188 (= R217), L192 (≠ W221)
- binding zinc ion: C99 (≠ A108), C101 (≠ A130), Y113 (≠ T142), C117 (≠ V146)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
28% identity, 60% coverage: 4:306/502 of query aligns to 10:278/455 of 3aiiA
O13775 Probable glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 61% coverage: 1:306/502 of query aligns to 203:488/716 of O13775
Sites not aligning to the query:
- 190 modified: Phosphoserine
Query Sequence
>CA265_RS21610 FitnessBrowser__Pedo557:CA265_RS21610
MDKKVRVRFAPSPTGGLHLGGVRTALFNYLFAKRNNGTFVLRVEDTDQNRFVEGAEQYIV
NCLDWCGITPDESPDNPGAYGPYRQSERKPSYRKFAEQLISDGYAYYAFDTPEDLDAKRK
EIPNFQYGQATRMQMRNSLTLTISEVEELLAAKTPHVIRIKVPADEIVHFNDLIRGDVSF
ETSLVDDKVLLKADGMPTYHLAVVVDDKAMEITHAFRGEEWLPSAPVHILLWKYLGWEAD
MPAWAHLPLILKPDGHGKLSKRDGDRLGFPVYAMNWTDPKTGDVTKGFKEMGFMPEAFIN
MLALLGWNDGTDQELFSLKELEEKFSIERISKAGAKFDFEKAKWYNHEWIKSQGAERLAP
TVKEELEKAGIEVNDHAFLNTVIDLIKDRCTLLPDFVAQSSYFFASPEVYDVNSVKPKWT
VEKADFFNAFADGLTLTDAVSAEAAFKALAEEKGFKPGELMLPFRIMLVGGKFGPGVFDI
AVLLGVAETKTRITKAIAVFNS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory