SitesBLAST – Find functional sites

 

SitesBLAST

Comparing CA265_RS21920 FitnessBrowser__Pedo557:CA265_RS21920 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 2 hits to proteins with known functional sites (download)

Q68CP4 Heparan-alpha-glucosaminide N-acetyltransferase; Transmembrane protein 76; EC 2.3.1.78 from Homo sapiens (Human) (see 10 papers)
28% identity, 80% coverage: 7:315/386 of query aligns to 267:611/663 of Q68CP4

query
sites
Q68CP4
R
 
R
L
 
L
L
 
R
S
 
S
L
 
V
D
 
D
F
 
T
F
 
F
R
 
R
G
 
G
L
 
I
T
 
A
V
 
L
A
 
I
A
 
L
M
 
M
I
 
V
L
 
F
V
 
V
N
 
N
N
 
Y
P
 
G
G
 
G
S
x
G
W
 
-
G
 
-
H
 
-
I
 
K
Y
 
Y
A
 
W
P
 
Y
L
 
F
E
 
K
H
|
H
A
 
A
E
 
S
W
 
W
N
|
N
G
 
G
C
 
L
T
 
T
P
 
V
T
 
A
D
 
D
L
 
L
I
 
V
F
 
F
P
|
P
F
 
W
F
 
F
L
 
V
W
 
F
I
 
I
V
 
M
G
 
G
V
 
S
S
 
S
I
 
I
A
 
F
F
 
L
A
 
S
M
 
M
S
 
T
S
 
S
S
 
I
K
 
L
T
 
Q
D
 
R
P
 
G
T
x
C
T
 
S
H
 
K
Q
 
F
K
 
R
T
 
L
I
 
L
I
 
G
K
 
K
A
 
I
I
 
A
K
 
W
R
 
R
G
 
S
I
 
F
I
 
L
L
 
L
Y
 
I
L
 
C
L
 
I
G
 
G
F
 
I
F
 
I
L
 
I
A
 
V
I
 
N
F
 
P
G
 
N
K
 
Y
I
 
C
I
 
L
S
 
G
A
 
P
I
 
L
I
 
-
D
 
-
G
 
-
R
 
-
S
 
-
I
 
-
W
 
-
E
 
-
A
 
S
F
 
W
Q
 
D
T
 
K
V
 
V
R
|
R
L
 
I
L
 
P
G
 
G
V
 
V
L
 
L
Q
 
Q
R
 
R
I
 
L
G
 
G
I
 
V
V
 
T
F
 
Y
I
 
F
I
 
V
S
 
V
S
 
A
I
 
V
-
 
L
-
 
E
-
 
L
I
 
L
F
 
F
I
 
A
K
 
K
-
 
P
-
 
V
-
 
P
-
 
E
-
 
H
-
x
C
V
 
A
S
 
S
N
 
E
K
 
R
T
 
S
I
 
C
F
 
L
K
 
S
-
 
L
-
 
R
-
 
D
-
 
I
-
 
T
-
 
S
-
 
S
-
 
W
-
 
P
-
 
Q
-
 
W
T
 
L
L
 
L
I
 
I
V
 
L
I
 
V
L
 
L
A
 
E
V
 
G
Y
 
L
W
|
W
A
 
L
L
 
G
M
 
L
T
 
T
F
 
F
-
 
L
I
 
L
P
 
P
V
 
V
P
 
P
G
 
G
V
 
C
-
 
P
-
 
T
-
 
G
-
 
Y
-
 
L
-
 
G
-
 
P
-
 
G
-
x
G
-
 
I
-
 
G
-
 
D
-
 
F
-
 
G
G
 
K
Y
 
Y
P
 
P
N
 
N
L
x
C
E
 
-
K
 
-
E
 
T
T
 
G
N
 
G
L
 
A
A
 
A
A
 
G
W
 
Y
I
 
I
D
 
D
R
 
R
G
x
L
I
 
L
L
 
L
T
 
G
E
 
D
A
 
D
H
|
H
T
 
L
W
 
Y
A
 
Q
S
 
H
S
 
P
K
 
S
T
 
S
-
 
A
-
 
V
-
 
L
-
 
Y
-
 
H
-
 
T
-
 
E
-
 
V
-
 
A
W
 
Y
D
 
D
P
 
P
E
|
E
G
 
G
I
 
I
L
 
L
S
 
G
T
 
T
L
 
I
P
 
N
A
 
S
I
 
I
G
x
V
T
x
M
C
 
A
L
 
F
F
 
L
G
|
G
I
 
V
L
 
Q
V
x
A
G
 
G
-
 
K
-
 
I
-
 
L
V
 
L
W
 
Y
M
 
Y
R
 
K
R
 
A
K
 
R
D
 
T
V
 
K
D
 
D
N
 
I
P
 
L
T
 
I
K
 
R
-
 
F
V
 
T
A
 
A
W
 
W
L
 
C
F
 
C
T
 
I
T
 
L
G
 
G
I
 
L
T
 
I
S
|
S
V
 
V
I
 
A
L
 
L
G
 
T
L
x
K
L
 
V
W
 
S
D
 
E
L
 
N
Q
 
E
-
 
G
-
 
F
F
 
I
P
 
P
I
 
V
N
 
N
K
 
K
A
 
N
L
 
L
W
 
W
T
x
S
S
 
L
S
|
S
Y
 
Y
V
 
V
L
 
T
Y
 
T
A
 
L
G
 
S
G
 
S
L
 
F
A
 
A
S
 
F
I
 
F
G
 
I
L
 
L
A
 
L
L
 
V
C
 
L
Y
 
Y
W
 
P
I
 
V
I
 
V
D
|
D
V
 
V
Q
 
K
G
 
G
Y
 
L
K
 
W
K
 
T
F
 
-
T
 
G
T
 
T
P
|
P
F
 
F
V
 
F
V
 
Y
Y
 
P
G
 
G
V
 
M
N
 
N
A
 
S
I
 
I
T
 
L
V
 
V
F
 
Y

Sites not aligning to the query:

Q3UDW8 Heparan-alpha-glucosaminide N-acetyltransferase; Transmembrane protein 76; EC 2.3.1.78 from Mus musculus (Mouse) (see paper)
27% identity, 80% coverage: 6:315/386 of query aligns to 259:604/656 of Q3UDW8

query
sites
Q3UDW8
Q
 
N
R
 
R
L
 
L
L
 
R
S
 
C
L
 
V
D
 
D
F
 
T
F
 
F
R
 
R
G
 
G
L
 
L
T
 
A
V
 
L
A
 
V
A
 
L
M
 
M
I
 
V
L
 
F
V
 
V
N
 
N
N
 
Y
P
 
G
G
 
G
S
 
G
W
 
-
G
 
-
H
 
-
I
 
K
Y
 
Y
A
 
W
P
 
Y
L
 
F
E
 
K
H
 
H
A
 
S
E
 
S
W
 
W
N
 
N
G
 
G
C
 
L
T
 
T
P
 
V
T
 
A
D
 
D
L
 
L
I
 
V
F
 
F
P
 
P
F
 
W
F
 
F
L
 
V
W
 
F
I
 
I
V
 
M
G
 
G
V
 
T
S
 
S
I
 
I
A
 
F
F
 
L
A
 
S
M
 
M
S
 
T
S
 
S
S
 
I
K
 
L
T
 
Q
D
 
R
P
 
G
T
 
C
T
 
S
H
 
K
Q
 
L
K
 
K
T
 
L
I
 
L
I
 
G
K
 
K
A
 
I
I
 
V
K
 
W
R
 
R
G
 
S
I
 
F
I
 
L
L
 
L
Y
 
I
L
 
C
L
 
I
G
 
G
F
 
V
F
 
I
L
 
I
A
 
V
I
 
N
F
 
P
G
 
N
K
 
Y
I
 
C
I
 
L
S
 
G
A
 
P
I
 
L
I
 
-
D
 
-
G
 
-
R
 
-
S
 
-
I
 
-
W
 
-
E
 
-
A
 
S
F
 
W
Q
 
D
T
 
K
V
 
V
R
 
R
L
 
I
L
 
P
G
 
G
V
 
V
L
 
L
Q
 
Q
R
 
R
I
 
L
G
 
G
I
 
V
V
 
T
F
 
Y
I
 
F
I
 
V
S
 
V
S
 
A
I
 
V
I
 
L
-
 
E
-
 
F
-
 
F
-
 
F
F
 
W
I
 
K
K
 
P
V
 
V
S
 
P
N
 
D
K
 
S
T
 
C
I
 
T
F
 
L
K
 
E
-
 
S
-
 
S
-
 
C
-
 
F
-
 
S
-
 
L
-
 
R
-
 
D
-
 
I
-
 
T
-
 
S
-
 
S
-
 
W
-
 
P
-
 
Q
-
 
W
-
 
L
T
 
T
L
 
I
I
 
L
V
 
T
I
 
L
L
 
E
A
 
S
V
 
I
Y
 
W
W
 
L
A
 
A
L
 
L
M
 
T
T
 
F
F
 
F
I
 
L
P
 
P
V
 
V
P
 
P
G
 
G
V
 
C
-
 
P
-
 
T
-
 
G
-
 
Y
-
 
L
-
 
G
-
 
P
-
 
G
G
 
G
Y
 
I
P
 
G
N
 
D
L
 
L
E
 
G
K
 
K
E
 
Y
T
 
P
N
 
H
L
 
C
-
 
T
-
 
G
-
 
G
-
 
A
A
 
A
A
 
G
W
 
Y
I
 
I
D
 
D
R
 
R
G
 
L
I
 
L
L
 
L
T
 
G
E
 
D
A
 
N
H
 
H
T
 
L
W
 
Y
A
 
Q
S
 
H
S
 
P
K
 
S
T
 
S
-
 
T
-
 
V
-
 
L
-
 
Y
-
 
H
-
 
T
-
 
E
-
 
V
-
 
A
W
 
Y
D
 
D
P
 
P
E
 
E
G
 
G
I
 
V
L
 
L
S
 
G
T
 
T
L
 
I
P
 
N
A
 
S
I
 
I
G
 
V
T
 
M
C
 
A
L
 
F
F
 
L
G
 
G
I
 
V
L
 
Q
V
 
A
G
 
G
-
 
K
-
 
I
-
 
L
V
 
V
W
 
Y
M
 
Y
R
 
K
R
 
D
K
 
Q
D
 
T
V
 
K
D
 
A
N
 
I
P
 
L
T
 
T
K
 
R
-
 
F
V
 
A
A
 
A
W
 
W
L
 
C
F
 
C
T
 
I
T
 
L
G
 
G
I
 
L
T
 
I
S
 
S
V
 
I
I
 
V
L
 
L
G
 
T
L
 
K
L
 
V
W
 
S
D
 
A
L
 
N
Q
 
E
-
 
G
-
 
F
F
 
I
P
 
P
I
 
I
N
 
N
K
 
K
A
 
N
L
 
L
W
 
W
T
 
S
S
 
I
S
 
S
Y
 
Y
V
 
V
L
 
T
Y
 
T
A
 
L
G
 
S
G
 
C
L
 
F
A
 
A
S
 
F
I
 
F
G
 
I
L
 
L
A
 
L
L
 
I
C
 
L
Y
 
Y
W
 
P
I
 
V
I
 
V
D
 
D
V
 
V
Q
 
K
G
 
G
Y
 
L
K
 
W
K
 
T
F
 
-
T
 
G
T
 
T
P
 
P
F
 
F
V
 
F
V
 
Y
Y
 
P
G
 
G
V
 
M
N
 
N
A
 
S
I
 
I
T
 
L
V
 
V
F
 
Y

Sites not aligning to the query:

Query Sequence

>CA265_RS21920 FitnessBrowser__Pedo557:CA265_RS21920
MTEPKQRLLSLDFFRGLTVAAMILVNNPGSWGHIYAPLEHAEWNGCTPTDLIFPFFLWIV
GVSIAFAMSSSKTDPTTHQKTIIKAIKRGIILYLLGFFLAIFGKIISAIIDGRSIWEAFQ
TVRLLGVLQRIGIVFIISSIIFIKVSNKTIFKTLIVILAVYWALMTFIPVPGVGYPNLEK
ETNLAAWIDRGILTEAHTWASSKTWDPEGILSTLPAIGTCLFGILVGVWMRRKDVDNPTK
VAWLFTTGITSVILGLLWDLQFPINKALWTSSYVLYAGGLASIGLALCYWIIDVQGYKKF
TTPFVVYGVNAITVFFLAGLMPRVLNLIQITKPDGTKTGLLVRFYETCYTPFFSPINASL
VWAITYVLGFYVLLYFMYKKNIIIKV

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory