Comparing CA265_RS21925 FitnessBrowser__Pedo557:CA265_RS21925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
2bkxA Structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the nagb superfamily (see paper)
46% identity, 36% coverage: 30:259/641 of query aligns to 15:239/242 of 2bkxA
2bkvB Structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the nagb superfamily (see paper)
46% identity, 36% coverage: 30:259/641 of query aligns to 15:239/242 of 2bkvB
O35000 Glucosamine-6-phosphate deaminase 1; GlcN6P deaminase 1; GNPDA 1; Glucosamine-6-phosphate isomerase 1; EC 3.5.99.6 from Bacillus subtilis (strain 168) (see paper)
46% identity, 36% coverage: 30:259/641 of query aligns to 15:239/242 of O35000
5hj5B Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from vibrio cholerae with beta-d-glucose-6-phosphate and fructose-6-phosphate
38% identity, 39% coverage: 24:274/641 of query aligns to 14:264/267 of 5hj5B
Sites not aligning to the query:
2wu1A Glucosamine-6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucoamine-6-phosphate both in the active and allosteric sites.
38% identity, 36% coverage: 32:261/641 of query aligns to 19:247/266 of 2wu1A
1horA Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution (see paper)
38% identity, 36% coverage: 32:261/641 of query aligns to 19:247/266 of 1horA
1fqoA Glucosamine 6-phosphate deaminase complexed with the substrate of the reverse reaction fructose 6-phosphate (open form) (see paper)
38% identity, 36% coverage: 32:261/641 of query aligns to 19:247/266 of 1fqoA
1deaA Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution (see paper)
38% identity, 36% coverage: 32:261/641 of query aligns to 19:247/266 of 1deaA
P0A759 Glucosamine-6-phosphate deaminase; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase; EC 3.5.99.6 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 36% coverage: 32:261/641 of query aligns to 19:247/266 of P0A759
P46926 Glucosamine-6-phosphate isomerase 1; Glucosamine-6-phosphate deaminase 1; GNPDA 1; GlcN6P deaminase 1; Oscillin; EC 3.5.99.6 from Homo sapiens (Human) (see paper)
42% identity, 33% coverage: 50:261/641 of query aligns to 37:247/289 of P46926
Sites not aligning to the query:
1ne7A Human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino- glucitol-6-phosphate (see paper)
42% identity, 33% coverage: 50:261/641 of query aligns to 37:247/281 of 1ne7A
Sites not aligning to the query:
3hn6A Crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi
40% identity, 37% coverage: 24:261/641 of query aligns to 17:250/271 of 3hn6A
2ri1A Crystal structure of glucosamine 6-phosphate deaminase (nagb) with glcn6p from s. Mutans (see paper)
40% identity, 33% coverage: 50:259/641 of query aligns to 33:233/235 of 2ri1A
8bgoG N,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose (see paper)
45% identity, 7% coverage: 357:403/641 of query aligns to 36:82/271 of 8bgoG
Sites not aligning to the query:
>CA265_RS21925 FitnessBrowser__Pedo557:CA265_RS21925
MARLNLLEETRFEKLPVSVFENPKIASINVAHRIAELIKSKQANNTPAVLGLATGVTPIA
VYAELVRLHKEEGLSFKNVITFNLDEYYPMAPTAAQSYVTFMNENLFNHIDIDKKNVHIP
DGTLALEDIPAFCLEYEKKIGDLGGLDIQILGIGRTGHIGFNEPGSAPNSGTRLVTLDDL
TRRDAARDFGGKTFVPTKAITMGIGTIFKAREIILMAWSRKKASIIKKAVEGEISGDVPA
TFLQLSDHVEFILDAPAASELTRFYTPWLVKDCVWTDALIRKAVIWLANTLKKPILKLTE
DDYNNNGMAQLATEKGPVYNINIHIFNKLQHTITGWPGGKPNADDSQRPERAEPAKKRVI
IFSPHPDDDVISMGGTFLRLVDQGHDVHVAYQTSGNTAVWDDDALRFVEFNVDFTEKMGM
DNTHLKDLYNKMRAFIEQKKPNQIDTPEIQTVKGLIRKGEAIAGARYCGLEDDHIHFQAL
PFYESGKVQKNPVTDADIELTIELLQKVKPQQVYAAGDFEDPHGTHIVCFNIILEALKRL
RKTEAWAQDCWLWMYRGAWHEFETHEIEMAVPISPQELERKKYAIFKHQSQKDRAVFPGD
DSREFWQRAEDRNRDTAKAYDELGLAEYEAMEAFVRWKFED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory