SitesBLAST
Comparing CA265_RS22390 FitnessBrowser__Pedo557:CA265_RS22390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 69% coverage: 76:370/428 of query aligns to 63:375/446 of A0A0H2VG78
- R102 (= R123) mutation to A: Loss of transport activity.
- I105 (≠ Q126) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E143) mutation to A: Loss of transport activity.
- Q137 (≠ Y158) mutation to A: Loss of transport activity.
- Q250 (≠ M260) mutation to A: Loss of transport activity.
- Q251 (= Q261) mutation to A: Loss of transport activity.
- N256 (= N266) mutation to A: Loss of transport activity.
- W357 (≠ A352) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 48% coverage: 12:218/428 of query aligns to 62:277/587 of P25297
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 6 papers)
26% identity, 50% coverage: 61:275/428 of query aligns to 104:317/524 of P11168
- T110 (≠ M67) to I: in dbSNP:rs5400
- V197 (≠ I162) to I: in NIDDM; abolishes transport activity of the transporter expressed in Xenopus oocytes; dbSNP:rs121909741
Sites not aligning to the query:
- 68 P → L: in dbSNP:rs7637863
- 322 I→V: Reduced fructose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 84% coverage: 70:427/428 of query aligns to 66:469/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 84% coverage: 70:427/428 of query aligns to 66:469/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 84% coverage: 70:427/428 of query aligns to 66:469/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 84% coverage: 70:427/428 of query aligns to 70:473/491 of P0AGF4
- G83 (= G83) mutation to A: Abolishes xylose transport.
- R133 (= R123) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E143) mutation to A: Abolishes xylose transport.
- R160 (= R150) mutation to A: Abolishes xylose transport.
- Q168 (≠ Y158) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ M260) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ MQ 260:261) binding
- Q289 (= Q261) mutation to A: Strongly decreases xylose transport.
- N294 (= N266) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ H269) mutation to A: Abolishes xylose transport.
- N325 (≠ Q290) mutation to A: No effect on xylose transport.
- G340 (= G301) mutation to A: Abolishes xylose transport.
- R341 (= R302) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ A352) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E357) mutation to A: Abolishes xylose transport.
- R404 (= R364) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ G381) binding
- W416 (vs. gap) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 59% coverage: 80:330/428 of query aligns to 93:367/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
O15244 Solute carrier family 22 member 2; Organic cation transporter 2; hOCT2 from Homo sapiens (Human) (see 8 papers)
25% identity, 71% coverage: 63:368/428 of query aligns to 158:467/555 of O15244
- M165 (≠ W73) to I: lower Vmax for MPP(+) transport; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177507
- Y169 (≠ S77) mutation to F: No change in TEA uptake.
- T201 (≠ K109) to M: in dbSNP:rs145450955
- Y241 (≠ Q157) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-362 and F-377.
- Y257 (≠ L173) mutation to F: No change in TEA uptake.
- S270 (≠ E184) to A: decreased Ki value for TBA inhibition of MPP(+); no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs316019
- Y279 (≠ W188) mutation to F: No change in TEA uptake.
- Y280 (≠ G189) mutation to F: No change in TEA uptake.
- P284 (= P193) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- PESPR 284:288 (≠ P---- 193) Proline-rich sequence
- S286 (vs. gap) mutation to A: No change in TEA and metformin uptake. No change in tyrosine phosphorylation.
- P287 (vs. gap) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- Y362 (≠ Q261) mutation to F: Decreased TEA uptake and YES1-mediated tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-241. Strong decrease in TEA uptake; when associated with F-377. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-377.
- Y377 (≠ T276) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-362.
- R400 (≠ K299) to C: lower Vmax and reduced Ki value for TBA inhibition of MPP(+); lower transport efficiency (Vmax/Km) and clearance of cyclo(his-pro); no change in transport efficiency (Vmax/Km) and clearance of salsolinol; dbSNP:rs8177516
- K432 (≠ I332) to Q: lower Km value for MPP(+) and reduced Ki value for TBA inhibition of MPP; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177517
- Y458 (≠ F359) mutation to F: No change in TEA uptake.
Sites not aligning to the query:
- 54 P → S: in dbSNP:rs8177504
- 73 Y→F: No change in TEA uptake.
- 92 Y→F: No change in TEA uptake.
- 128 Y→F: No change in TEA uptake.
- 544 Y→F: No change in TEA uptake.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 37% coverage: 70:227/428 of query aligns to 98:261/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
23% identity, 72% coverage: 59:368/428 of query aligns to 154:467/555 of Q9R0W2
- C451 (≠ A352) Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; mutation to M: Transport activity strongly reduced.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 68% coverage: 76:368/428 of query aligns to 78:381/452 of Q5EXK5
- D82 (= D80) mutation to A: Loss of activity.
- V311 (≠ L295) mutation to W: Loss of activity.
- D314 (= D298) mutation to A: Loss of activity.
5c65A Structure of the human glucose transporter glut3 / slc2a3
28% identity, 32% coverage: 47:182/428 of query aligns to 47:181/457 of 5c65A
Sites not aligning to the query:
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
28% identity, 32% coverage: 47:182/428 of query aligns to 51:185/470 of 7sptA
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
28% identity, 32% coverage: 47:182/428 of query aligns to 48:182/468 of 7spsA
Sites not aligning to the query:
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: 21, 25, 29, 278, 286, 308, 312, 374, 375, 406, 407, 410
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
28% identity, 32% coverage: 47:182/428 of query aligns to 49:183/469 of 7crzA
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: 26, 278, 279, 284, 313, 375, 384, 411, 412, 415
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
28% identity, 32% coverage: 47:182/428 of query aligns to 51:185/470 of 4zw9A
Sites not aligning to the query:
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
28% identity, 32% coverage: 47:182/428 of query aligns to 51:185/496 of P11169
Sites not aligning to the query:
- 277:279 Important for selectivity against fructose; QLS→HVA: Confers moderate fructose transport activity.
- 280:281 binding
- 286 binding
- 315 binding
- 378 binding
- 386 binding
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 40% coverage: 49:221/428 of query aligns to 73:230/444 of Q8NLB7
- R103 (≠ K81) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Query Sequence
>CA265_RS22390 FitnessBrowser__Pedo557:CA265_RS22390
MHQNEIKDVEYRLKSIFGGSVGNLVEWYDWYTYSAFALYFSPAFFPNSNPTAQLLDTAGI
FAVGFLMRPIGGWLFGSIADKLGRKRSMTLSVLIMAIGSLIIGLTPGYKQIGIAAPLLLI
FARLIQGLSTGGEYGTSATYLSEMATKKHRGFYSSFQYVTLIGGQLLALGIQLILQNWLL
TPAELHEWGWRIPFFIGAILSFIALYLRRHIDETSAFKSKNTADKKGGIAVLMKYPKEVF
TVVGLTLGGTIAFYTFSTYMQKFLVNTVHLSKETSTTLSFISLLVFVVLQPLFGLLSDKI
GRKPLLIGFGVLGTLCTYPILTGLAGESNTTIIFLLMIGALIIVSGYTSINAVVKAELFP
AEIRALGVGLPYALTVAIFGGTAEYFALWFKNIGHENYFYWYVTGCILISLILYTTMKDT
KHHSKIED
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory