Comparing CA265_RS22635 FitnessBrowser__Pedo557:CA265_RS22635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3kd3A Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. Tularensis schu s4
31% identity, 48% coverage: 9:217/433 of query aligns to 5:211/216 of 3kd3A
6q6jB Human phosphoserine phosphatase with substrate analogue homo-cysteic acid (see paper)
26% identity, 48% coverage: 11:218/433 of query aligns to 16:216/217 of 6q6jB
6hyjB Psph human phosphoserine phosphatase (see paper)
26% identity, 48% coverage: 11:218/433 of query aligns to 20:220/223 of 6hyjB
1l8oA Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase (see paper)
26% identity, 48% coverage: 11:218/433 of query aligns to 17:217/222 of 1l8oA
1l8lA Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase (see paper)
26% identity, 48% coverage: 11:218/433 of query aligns to 17:217/222 of 1l8lA
6hyyA Human phosphoserine phosphatase with serine and phosphate (see paper)
26% identity, 48% coverage: 11:218/433 of query aligns to 16:216/221 of 6hyyA
P78330 Phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Homo sapiens (Human) (see 4 papers)
26% identity, 48% coverage: 11:218/433 of query aligns to 20:220/225 of P78330
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 24% coverage: 332:433/433 of query aligns to 308:410/410 of P0A9T0
Sites not aligning to the query:
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
35% identity, 24% coverage: 332:433/433 of query aligns to 304:406/406 of 1ybaA
Sites not aligning to the query:
1sc6D Crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with NAD+ (see paper)
35% identity, 24% coverage: 332:433/433 of query aligns to 282:384/384 of 1sc6D
Sites not aligning to the query:
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
35% identity, 24% coverage: 332:433/433 of query aligns to 302:404/404 of 1psdA
Sites not aligning to the query:
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
35% identity, 24% coverage: 332:433/433 of query aligns to 304:406/406 of 2p9eA
Sites not aligning to the query:
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
28% identity, 45% coverage: 1:193/433 of query aligns to 1:186/211 of Q58989
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
28% identity, 44% coverage: 3:193/433 of query aligns to 2:185/210 of 1f5sA
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
28% identity, 44% coverage: 3:193/433 of query aligns to 1:184/209 of 1l7nA
6iuyA Structure of dsgpdh of dunaliella salina (see paper)
26% identity, 28% coverage: 97:218/433 of query aligns to 100:220/585 of 6iuyA
Sites not aligning to the query:
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
27% identity, 44% coverage: 4:193/433 of query aligns to 1:183/208 of 1l7pA
7qplA Crystal structure of phosphoserine phosphatase (serb) from brucella melitensis in complex with phosphate and magnesium
26% identity, 43% coverage: 3:187/433 of query aligns to 78:258/295 of 7qplA
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 24% coverage: 332:433/433 of query aligns to 360:466/466 of P87228
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
25% identity, 21% coverage: 237:325/433 of query aligns to 10:102/533 of O43175
Sites not aligning to the query:
>CA265_RS22635 FitnessBrowser__Pedo557:CA265_RS22635
MPKQKAYYIIDFDSTFTQVEALDELARISLKNHPDKEAIFQKIEDYTNFAMEGKLSFSES
LAQRVKLLEANEDHLKQLIKHLKKKVSTSFSRNAEFFKKHADEVLIVSGGFKEFITPVVS
QYHIKKENIYANTFVTTGDGKIIDYDHANPLSEEGGKVKLLQHLKLEGELFGIGDGYSDF
QLRESGIINKFFAFTENIARESIVSKADHVTPSFDEFLYVNDLPRAISYPKNRILCLVIG
DVDPLTIAILKNDGLSIRHKTSFEDKYVKDVGIILLADGEKINKEQLKNAAKLKTIGYLG
NAKNKIDLDLCTKQGIVVFDDPKNNPRNIDFIPKRVADFMNTGATYLSSNFPNLQLPKIE
KSHRLIHIHKNVPGIMAKINTVFAKHDINIVSQFLMTNPEIGYAITDINAEYDKQLFKSL
KKIEHTIKFRVLY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory