SitesBLAST
Comparing CA265_RS22650 FitnessBrowser__Pedo557:CA265_RS22650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
41% identity, 90% coverage: 32:350/354 of query aligns to 3:330/335 of 3ht5A
- active site: K171 (= K195)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R96), K171 (= K195), Y176 (= Y200), E207 (= E231), G210 (≠ T234), M211 (≠ A235), N212 (= N236), L235 (= L255), G237 (= G257), I238 (≠ V258), T239 (= T259), T281 (= T301)
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
43% identity, 92% coverage: 27:350/354 of query aligns to 26:358/363 of 3dtgA
- active site: K199 (= K195)
- binding O-benzylhydroxylamine: F72 (= F72), Y171 (= Y170), Y204 (= Y200)
- binding pyridoxal-5'-phosphate: R96 (= R96), R189 (= R185), K199 (= K195), Y204 (= Y200), E235 (= E231), G238 (≠ T234), L263 (= L255), I266 (≠ V258), T267 (= T259), T309 (= T301)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
43% identity, 92% coverage: 27:350/354 of query aligns to 26:358/363 of 3dtfA
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
43% identity, 92% coverage: 27:350/354 of query aligns to 31:363/368 of A0R066
- R101 (= R96) binding
- Y209 (= Y200) binding
- K299 (≠ E286) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T301) binding
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
41% identity, 90% coverage: 32:350/354 of query aligns to 2:321/326 of 5u3fA
- active site: K162 (= K195)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G74), R67 (= R96), Y110 (= Y138), K162 (= K195), Y167 (= Y200), E198 (= E231), G201 (≠ T234), M202 (≠ A235), N203 (= N236), L226 (= L255), G228 (= G257), I229 (≠ V258), T230 (= T259), T272 (= T301)
7nyaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor bay-069 (compound 36) (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 21:353/364 of 7nyaA
- binding pyridoxal-5'-phosphate: R97 (= R96), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), M239 (≠ A235), L264 (= L255), G266 (= G257), V267 (= V258), T268 (= T259), G310 (= G300), T311 (= T301)
- binding 3-[4-chloranyl-3-(2-methylphenoxy)naphthalen-1-yl]-6-(trifluoromethyl)-5~{H}-pyrimidine-2,4-dione: F27 (= F27), Y68 (= Y67), F73 (= F72), Y139 (= Y138), G152 (= G151), V153 (= V152), Y171 (= Y170), Q212 (≠ F207), Q222 (= Q217), T238 (= T234), A312 (= A302)
7ny9A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 38 (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 21:353/364 of 7ny9A
- binding pyridoxal-5'-phosphate: R97 (= R96), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), M239 (≠ A235), N240 (= N236), L264 (= L255), G266 (= G257), V267 (= V258), T268 (= T259), T311 (= T301)
- binding 3-[2,6-bis(oxidanylidene)-4-(trifluoromethyl)-5~{H}-pyrimidin-1-yl]-~{N}-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridine-7-carboxamide: F27 (= F27), Y139 (= Y138), G152 (= G151), V153 (= V152), Y171 (= Y170), Q212 (≠ F207), Q221 (≠ D216), Q222 (= Q217), V223 (≠ L218), T238 (= T234)
7ny2A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 35 (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 21:353/364 of 7ny2A
- binding pyridoxal-5'-phosphate: R97 (= R96), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), M239 (≠ A235), L264 (= L255), G266 (= G257), V267 (= V258), T268 (= T259), T311 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-2-(2-methylphenoxy)naphthalene-1-carbonitrile: F27 (= F27), Y139 (= Y138), G152 (= G151), V153 (= V152), Y171 (= Y170), Q212 (≠ F207), Q222 (= Q217), A312 (= A302)
7nwmA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 12 (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:354/365 of 7nwmA
- binding pyridoxal-5'-phosphate: R98 (= R96), R191 (= R185), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (= T234), M240 (≠ A235), L265 (= L255), G267 (= G257), V268 (= V258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methoxy-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F27), Y69 (= Y67), F74 (= F72), Y140 (= Y138), G153 (= G151), V154 (= V152), Y172 (= Y170), Q213 (≠ F207), Q223 (= Q217), T239 (= T234), A313 (= A302)
7nweA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 10 (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:354/365 of 7nweA
- binding pyridoxal-5'-phosphate: R98 (= R96), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (= T234), M240 (≠ A235), L265 (= L255), G267 (= G257), V268 (= V258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F27), Y69 (= Y67), F74 (= F72), Y140 (= Y138), G153 (= G151), V154 (= V152), Y172 (= Y170), Q213 (≠ F207), Q223 (= Q217), T239 (= T234), A313 (= A302)
7nwcA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 2 (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:354/365 of 7nwcA
- binding pyridoxal-5'-phosphate: R98 (= R96), R191 (= R185), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (= T234), M240 (≠ A235), N241 (= N236), L265 (= L255), G267 (= G257), V268 (= V258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 3-(5-chloranyl-2,4-dimethoxy-phenyl)-6-(trifluoromethyl)-1H-pyrimidine-2,4-dione: F28 (= F27), Y172 (= Y170), Q223 (= Q217), T239 (= T234), A313 (= A302)
7nwbA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 1 (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:354/365 of 7nwbA
- binding pyridoxal-5'-phosphate: R98 (= R96), R191 (= R185), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (= T234), M240 (≠ A235), L265 (= L255), G267 (= G257), V268 (= V258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F27), Y69 (= Y67), F74 (= F72), Y140 (= Y138), G153 (= G151), V154 (= V152), Y172 (= Y170), Q213 (≠ F207), Q223 (= Q217), A313 (= A302)
7nwaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and compound a (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:354/365 of 7nwaA
- binding pyridoxal-5'-phosphate: R98 (= R96), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (= T234), N241 (= N236), L265 (= L255), G267 (= G257), V268 (= V258), T269 (= T259), T312 (= T301)
- binding 2-[[4-chloranyl-2,6-bis(fluoranyl)phenyl]methylamino]-7-oxidanylidene-5-propyl-4H-pyrazolo[1,5-a]pyrimidine-3-carbonitrile: R142 (= R140), G153 (= G151), V154 (= V152), Y172 (= Y170), F173 (≠ Y171), V181 (≠ L175), Q223 (= Q217), V237 (≠ A232), T239 (= T234), M240 (≠ A235), G311 (= G300), A313 (= A302), C317 (≠ T306)
7nxnA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 21(5-f) (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:351/362 of 7nxnA
- binding pyridoxal-5'-phosphate: R98 (= R96), R188 (= R185), K198 (= K195), Y203 (= Y200), E233 (= E231), T236 (= T234), M237 (≠ A235), N238 (= N236), L262 (= L255), G264 (= G257), V265 (= V258), T266 (= T259), T309 (= T301)
- binding 4-[6-[bis(fluoranyl)-phenyl-methyl]-2,4-bis(oxidanylidene)-1~{H}-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F27), Y69 (= Y67), F74 (= F72), G153 (= G151), V154 (= V152), Y172 (= Y170), Q210 (≠ F207), Q219 (≠ D216), Q220 (= Q217), T236 (= T234)
7ntrA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and substrate mimic 3-phenylpropionate (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 22:351/362 of 7ntrA
- binding hydrocinnamic acid: F28 (= F27), Y69 (= Y67), V154 (= V152), T236 (= T234), G308 (= G300), T309 (= T301), A310 (= A302)
- binding pyridoxal-5'-phosphate: R98 (= R96), R188 (= R185), K198 (= K195), Y203 (= Y200), E233 (= E231), T236 (= T234), M237 (≠ A235), L262 (= L255), G264 (= G257), V265 (= V258), T266 (= T259), G308 (= G300), T309 (= T301)
7nxoA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 24(5-f) (see paper)
36% identity, 91% coverage: 21:342/354 of query aligns to 21:350/361 of 7nxoA
- binding pyridoxal-5'-phosphate: R97 (= R96), K197 (= K195), Y202 (= Y200), E232 (= E231), T235 (= T234), M236 (≠ A235), N237 (= N236), L261 (= L255), G263 (= G257), V264 (= V258), T265 (= T259), T308 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(phenylsulfonyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F27 (= F27), Y68 (= Y67), F73 (= F72), G152 (= G151), V153 (= V152), Y171 (= Y170), F172 (≠ Y171), Q209 (≠ F207), Q218 (≠ D216), Q219 (= Q217), T235 (= T234)
2abjA Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate. (see paper)
35% identity, 91% coverage: 21:342/354 of query aligns to 23:355/366 of 2abjA
- active site: K202 (= K195)
- binding n'-(5-chlorobenzofuran-2-carbonyl)-2-(trifluoromethyl)benzenesulfonohydrazide: F29 (= F27), F75 (= F72), Y141 (= Y138), Y173 (= Y170), K202 (= K195), Q224 (= Q217), T240 (= T234), M241 (≠ A235), G312 (= G300), A314 (= A302), C315 (≠ A303)
- binding pyridoxal-5'-phosphate: R99 (= R96), R192 (= R185), K202 (= K195), Y207 (= Y200), E237 (= E231), T240 (= T234), M241 (≠ A235), N242 (= N236), L266 (= L255), G268 (= G257), V269 (= V258), T270 (= T259), T313 (= T301)
2coiA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with gabapentin (see paper)
35% identity, 90% coverage: 24:342/354 of query aligns to 24:348/358 of 2coiA
- active site: K195 (= K195)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: Y68 (= Y67), R141 (= R140), V153 (= V152), T233 (= T234), G305 (= G300), T306 (= T301), A307 (= A302)
- binding pyridoxal-5'-phosphate: R97 (= R96), R185 (= R185), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (= T234), L259 (= L255), G261 (= G257), V262 (= V258), T263 (= T259), T306 (= T301)
2cogA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with 4-methylvalerate (see paper)
35% identity, 90% coverage: 24:342/354 of query aligns to 24:348/358 of 2cogA
- active site: K195 (= K195)
- binding 4-methyl valeric acid: Y171 (= Y170), T233 (= T234), T306 (= T301), A307 (= A302)
- binding pyridoxal-5'-phosphate: R97 (= R96), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (= T234), L259 (= L255), G261 (= G257), V262 (= V258), T263 (= T259), T306 (= T301)
5i5xA X-ray crystal structure at 1.65a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a thiazole compound and pmp cofactor. (see paper)
32% identity, 92% coverage: 25:348/354 of query aligns to 23:354/358 of 5i5xA
- active site: K195 (= K195)
- binding 5-methyl-4-oxo-N-(1,3,4-thiadiazol-2-yl)-3,4-dihydrothieno[2,3-d]pyrimidine-6-carboxamide: F25 (= F27), F70 (= F72), K74 (= K76), Y136 (= Y138), V165 (≠ T167), Y168 (= Y170), A307 (= A302)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R94 (= R96), R185 (= R185), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (= T234), M234 (≠ A235), N235 (= N236), L259 (= L255), G261 (= G257), V262 (= V258), V263 (≠ T259), T306 (= T301)
Query Sequence
>CA265_RS22650 FitnessBrowser__Pedo557:CA265_RS22650
MTETLDIKITKADQTRLTVTDFSQLPFGKVFTDHMFTADYEDGEWKNLQILPYGPIPMSP
AISALHYGQAIFEGLKAYRQPDGKISVFRADKNFERFNKSAARMSMPGIPEEIFMQGLAA
LINVDEKWVPNQEDYALYIRPVMFAMDPYLGVKASDTYKFALLTTPTGPYYSSALKVKIE
TEFTRADEGGVGFAKTAGNYARSLYPFEQAKKEGYDQLIWTDSVTHEFIEEAGTANLLFV
INGKLVTPSVRSTVLDGVTRDTIIKLAKDAGVEVEERRVSVKEVIEGIENGSLTEAFAAG
TAATVTHVGEMGYNGQIYKLTDPSTRHISNGIAKKLNDIRYGLAPDEFGWNWVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory