Comparing CA265_RS22825 FitnessBrowser__Pedo557:CA265_RS22825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
56% identity, 96% coverage: 5:125/126 of query aligns to 4:123/124 of 7cd4A
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
52% identity, 98% coverage: 2:124/126 of query aligns to 1:123/126 of 2b33B
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
52% identity, 97% coverage: 2:123/126 of query aligns to 3:125/127 of 5v4dA
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
48% identity, 100% coverage: 1:126/126 of query aligns to 5:130/137 of P80601
Sites not aligning to the query:
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
45% identity, 100% coverage: 1:126/126 of query aligns to 5:130/137 of P52759
Sites not aligning to the query:
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 98% coverage: 2:125/126 of query aligns to 64:187/187 of Q94JQ4
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
45% identity, 98% coverage: 2:125/126 of query aligns to 1:123/124 of 3k0tC
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
41% identity, 98% coverage: 2:124/126 of query aligns to 1:125/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
41% identity, 98% coverage: 2:124/126 of query aligns to 1:125/127 of 2uykC
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
45% identity, 98% coverage: 2:125/126 of query aligns to 4:127/128 of A0A1J1DL12
Sites not aligning to the query:
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
44% identity, 97% coverage: 3:124/126 of query aligns to 2:126/127 of 3vczB
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 98% coverage: 1:124/126 of query aligns to 1:126/128 of Q7CP78
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
43% identity, 84% coverage: 18:123/126 of query aligns to 1:106/108 of 5hp8A
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
30% identity, 97% coverage: 2:123/126 of query aligns to 3:124/128 of P0AFQ5
Q12429 Diphthine--ammonia ligase; Diphthamide synthase; Diphthamide synthetase; EC 6.3.1.14 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
21% identity, 75% coverage: 32:125/126 of query aligns to 312:418/685 of Q12429
Sites not aligning to the query:
>CA265_RS22825 FitnessBrowser__Pedo557:CA265_RS22825
MKQIIKTTNAPAPIGPYSQAVQAGNFLFVSGQVAINPESGELNIGNIEEETHQVMRNLKA
VLLEAGLTFDNVVKSTIFLSDMGTFAQVNEVYGQYFTADFPARETVQVSVLPKNVNVEIS
VIAIVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory