Comparing CA265_RS22900 FitnessBrowser__Pedo557:CA265_RS22900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
44% identity, 99% coverage: 2:259/260 of query aligns to 4:265/265 of 6y88B
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
42% identity, 92% coverage: 22:259/260 of query aligns to 15:252/253 of 6y88G
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
35% identity, 98% coverage: 2:257/260 of query aligns to 1:255/259 of 3t44A
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
35% identity, 98% coverage: 2:257/260 of query aligns to 1:255/258 of 3t55A
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
35% identity, 98% coverage: 2:257/260 of query aligns to 1:253/257 of 3t78A
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
37% identity, 97% coverage: 3:255/260 of query aligns to 4:251/259 of 1jcmP
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
38% identity, 85% coverage: 39:258/260 of query aligns to 36:254/254 of 1vc4B
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
37% identity, 98% coverage: 2:255/260 of query aligns to 3:251/452 of 1piiA
Sites not aligning to the query:
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
33% identity, 98% coverage: 2:257/260 of query aligns to 1:241/251 of 3t40A
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
36% identity, 79% coverage: 53:257/260 of query aligns to 52:254/470 of 7etyA
Sites not aligning to the query:
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
36% identity, 79% coverage: 53:257/260 of query aligns to 54:256/472 of 7etxA
Sites not aligning to the query:
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
34% identity, 80% coverage: 50:257/260 of query aligns to 45:246/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
34% identity, 80% coverage: 50:257/260 of query aligns to 45:246/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
34% identity, 80% coverage: 50:257/260 of query aligns to 45:246/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
34% identity, 80% coverage: 50:257/260 of query aligns to 45:246/247 of 1a53A
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
30% identity, 80% coverage: 50:257/260 of query aligns to 45:246/247 of 4iwwA
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
31% identity, 80% coverage: 50:257/260 of query aligns to 45:239/240 of 5k7jA
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
29% identity, 86% coverage: 34:257/260 of query aligns to 26:246/247 of 3uxdA
3uzjA Designed protein ke59 r13 3/11h with benzotriazole (see paper)
29% identity, 86% coverage: 34:257/260 of query aligns to 26:246/247 of 3uzjA
3uz5A Designed protein ke59 r13 3/11h (see paper)
29% identity, 86% coverage: 34:257/260 of query aligns to 26:246/247 of 3uz5A
>CA265_RS22900 FitnessBrowser__Pedo557:CA265_RS22900
MNILDKIVLRKKEEVAAAKALVSVQDLENSVHFKRAPYSFKEFLLAADRTGIIAEFKRRS
PSKGLINGVADVAEVTQAYNAAGASALSVLTDVDFFGGKTDDILAARAANHIPILRKDFM
IDTYQILEAKAWGADIILLIASILTPQQINDFGKFAKDLGLNVLLEVHNLEELERSICPN
LDAIGVNNRNLGDFTVDIQTSFDLVNKIPNEFLKISESAISNTQTIKDLKAAGFNGFLIG
ENFMKTDDPGVAIKEFVAQI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory