SitesBLAST
Comparing CA265_RS23325 CA265_RS23325 MFS transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
38% identity, 99% coverage: 3:439/443 of query aligns to 2:477/491 of P0AGF4
- F24 (= F25) mutation to A: Decreases xylose transport.
- G83 (= G76) mutation to A: Abolishes xylose transport.
- R133 (= R108) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E128) mutation to A: Abolishes xylose transport.
- R160 (= R135) mutation to A: Abolishes xylose transport.
- Q168 (= Q143) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q259) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 259:260) binding
- Q289 (= Q260) mutation to A: Strongly decreases xylose transport.
- N294 (= N265) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ N269) mutation to A: Abolishes xylose transport.
- N325 (= N296) mutation to A: No effect on xylose transport.
- G340 (= G311) mutation to A: Abolishes xylose transport.
- R341 (= R312) mutation R->A,W: Abolishes xylose transport.
- W392 (= W361) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E366) mutation to A: Abolishes xylose transport.
- R404 (= R373) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ L384) binding
- W416 (= W385) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
38% identity, 98% coverage: 6:439/443 of query aligns to 1:473/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
38% identity, 98% coverage: 6:439/443 of query aligns to 1:473/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
38% identity, 98% coverage: 6:439/443 of query aligns to 1:473/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
36% identity, 93% coverage: 28:437/443 of query aligns to 22:434/446 of A0A0H2VG78
- D22 (= D28) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R108) mutation to A: Loss of transport activity.
- I105 (≠ S111) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E128) mutation to A: Loss of transport activity.
- Q137 (= Q143) mutation to A: Loss of transport activity.
- Q250 (= Q259) mutation to A: Loss of transport activity.
- Q251 (= Q260) mutation to A: Loss of transport activity.
- N256 (= N265) mutation to A: Loss of transport activity.
- W357 (= W361) mutation to A: Loss of transport activity.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 98% coverage: 8:443/443 of query aligns to 22:492/514 of Q9LT15
- F39 (= F25) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ F29) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (≠ A53) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E128) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q143) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (= I150) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (= Q259) binding
- Q296 (= Q260) binding
- N301 (= N265) binding
- N332 (= N296) binding
- D344 (= D308) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W361) binding
- C449 (≠ D400) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
29% identity, 98% coverage: 8:443/443 of query aligns to 2:472/487 of 7aaqA
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
29% identity, 98% coverage: 8:443/443 of query aligns to 7:477/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ F29), I90 (≠ V71), H94 (≠ Y75), V98 (≠ P79), F101 (≠ M82), N138 (≠ S119), P142 (= P123), N158 (≠ V139), F161 (≠ N142), Q162 (= Q143), I165 (= I146), D210 (≠ E191), G391 (vs. gap), P392 (= P358), W395 (= W361), M419 (≠ W385)
- binding beta-D-glucopyranose: Q280 (= Q259), N286 (= N265), M289 (≠ F268), G391 (vs. gap), W395 (= W361)
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 4:439/443 of query aligns to 24:478/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 71% coverage: 6:318/443 of query aligns to 23:346/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 6 papers)
29% identity, 88% coverage: 45:436/443 of query aligns to 93:495/524 of P11168
- T110 (≠ V63) to I: in dbSNP:rs5400
- V197 (= V147) to I: in NIDDM; abolishes transport activity of the transporter expressed in Xenopus oocytes; dbSNP:rs121909741
- I322 (≠ V267) mutation to V: Reduced fructose transport.
Sites not aligning to the query:
- 68 P → L: in dbSNP:rs7637863
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
28% identity, 97% coverage: 8:436/443 of query aligns to 7:461/493 of P32037
- N43 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 99% coverage: 3:439/443 of query aligns to 78:548/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P10870 Low glucose sensor SNF3; High-affinity glucose receptor SNF3; High-affinity transporter-like sensor SNF3; Sucrose nonfermenting protein 3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
28% identity, 97% coverage: 14:441/443 of query aligns to 100:557/884 of P10870
- G112 (= G26) mutation to D: In SNF3-142.
- G153 (= G60) mutation to R: In SNF3-72.
- R229 (= R135) mutation to K: In SNF3-1; constitutively signaling glucose receptor.
- I374 (≠ V267) mutation to V: Decreases responsiveness to mannose and fructose.
- V402 (= V297) mutation to I: In SNF3-39.
- F462 (≠ Y352) mutation to Y: Decreases responsiveness to fructose.
Q12300 High glucose sensor RGT2; Low-affinity glucose receptor RGT2; Low-affinity transporter-like sensor RGT2; Restores glucose transport protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
30% identity, 96% coverage: 13:439/443 of query aligns to 101:558/763 of Q12300
- R231 (= R135) mutation to K: In RGT2-1; constitutively signaling glucose receptor.
Sites not aligning to the query:
- 684:690 SIISDST→AIIADAA: In Rgt2(4SA); Abolishes Yck-dependent phosphorylation, interaction with MTH1 and STD1, and glucose signaling, but does not affect protein stability.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 76% coverage: 3:338/443 of query aligns to 19:368/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
O74969 High-affinity glucose transporter ght2; Hexose transporter 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 98% coverage: 5:439/443 of query aligns to 8:470/531 of O74969
Sites not aligning to the query:
- 507 modified: Phosphoserine
- 515 modified: Phosphoserine
- 519 modified: Phosphoserine
- 520 modified: Phosphoserine
- 523 modified: Phosphotyrosine
P43427 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Rattus norvegicus (Rat) (see paper)
29% identity, 96% coverage: 16:439/443 of query aligns to 22:473/502 of P43427
- Y31 (≠ F25) binding
- Q166 (= Q143) binding ; mutation to E: Impairs D-fructose binding.
- Q287 (= Q259) binding
- IYY 295:297 (≠ VFN 267:269) binding
- H386 (≠ Y352) binding
- HW 418:419 (≠ LW 384:385) binding
Q94KE0 Sugar transporter ESL1; Protein EARLY-RESPONSIVE TO DEHYDRATION 6-LIKE 1; ERD six-like 1; Sugar transporter ERD6-like 3; Sugar transporter-like protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 86% coverage: 57:437/443 of query aligns to 78:462/470 of Q94KE0
Sites not aligning to the query:
- 10 L→A: Localizes mainly to the endoplasmic reticulum.
- 10:16 Essential for the localization to the vacuole membrane
- 14 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-15 and A-16.
- 15 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-14 and A-16.
- 16 L→A: Loss of localization to the vacuole membrane; when associated with A-14 and A-15.
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
27% identity, 98% coverage: 1:436/443 of query aligns to 1:461/496 of P11169
- Q159 (= Q143) binding
- QLS 277:279 (≠ AIF 256:258) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (= QQ 259:260) binding
- N286 (= N265) binding
- N315 (= N296) binding
- E378 (vs. gap) binding
- W386 (= W361) binding
Query Sequence
>CA265_RS23325 CA265_RS23325 MFS transporter
MSQSKFNTAYITFISLLAAGGGYLFGFDFAVISGSLPFLEKQFQLTPYWEGFATGSLALG
AMVGCLIAGYVSDAYGRKPGLMIAAFVFLASSLAMAMAPNRDFFIVSRFFSGIGVGMASM
LSPMYIAELAPPKFRGRLVAINQLTIVLGILITNLINYTLRNTGEDAWRWMFGLGAIPSG
IFLIGISILPESPRWLVQKGKNEKALKVLNKIGNHEFAADALKNIEQTLQRKSNVEHESI
FNKMYFPAVMIGIGLAIFQQFCGINTVFNYAPKLFESIGTSQDDQLLQTVFIGAVNVIFT
ISAMFLVDKIGRKPLMLIGAGGLAVLYVLISQLLASGSTMVSWFLLSAIGVYAVSLAPVT
WVLISEIFPNKVRVKATTWAILCLWGAYFVLVFTFPILFDWLKESIFYIYAAICTLGCIG
IWKFVKETKGKTLEEIEDIQIVH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory