Comparing CA265_RS23470 FitnessBrowser__Pedo557:CA265_RS23470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
35% identity, 89% coverage: 5:281/310 of query aligns to 2:280/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 99% coverage: 4:310/310 of query aligns to 53:365/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
38% identity, 87% coverage: 4:274/310 of query aligns to 2:268/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
38% identity, 87% coverage: 4:274/310 of query aligns to 2:268/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
38% identity, 87% coverage: 4:274/310 of query aligns to 2:268/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
38% identity, 87% coverage: 4:274/310 of query aligns to 2:268/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
38% identity, 87% coverage: 4:274/310 of query aligns to 2:268/296 of 1fwkA
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
29% identity, 95% coverage: 7:300/310 of query aligns to 12:293/295 of 6cyzA
6mdeA Mevalonate kinase from methanosarcina mazei with mevalonate bound (see paper)
34% identity, 33% coverage: 54:155/310 of query aligns to 51:151/302 of 6mdeA
Sites not aligning to the query:
6mdfA Mevalonate kinase from methanosarcina mazei with 5-phosphomevalonate bound (see paper)
34% identity, 33% coverage: 54:155/310 of query aligns to 52:152/303 of 6mdfA
Sites not aligning to the query:
>CA265_RS23470 FitnessBrowser__Pedo557:CA265_RS23470
MKDSIKVFAPATVANVVCGFDVLGFAVNEPGDEVEMRFTDTPGVVIKGITGDDGRLPLDA
AKNTVSASVQHYLKHINRLDVGVEIELHKKMPIGSGLGSSSASTVAGLFAINKLMGDLLS
TKELVPFAMKGEELACGYGHADNVAPALLGGFVLVRSYDPLDVISLPTPAGMYAAIVYPE
VDVPTKDARQMIRSKVALKDAVTQWGNVAGLVSGLFMNDFDLIGRSMKDVLVEPTRSILI
PGFEEMRKLAMENGAIGFGISGSGPSVFSLTKDEETARKITKSQQQHLHKININSKAFVS
PVNAEGPKVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory