Comparing CA265_RS23900 CA265_RS23900 N-acyl-L-amino acid amidohydrolase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 99% coverage: 2:392/394 of query aligns to 31:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 97% coverage: 12:392/394 of query aligns to 47:427/442 of P54968
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 95% coverage: 17:389/394 of query aligns to 10:373/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
36% identity, 94% coverage: 21:392/394 of query aligns to 20:388/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
34% identity, 91% coverage: 24:381/394 of query aligns to 26:386/398 of 6slfA
3ramA Crystal structure of hmra (see paper)
27% identity, 82% coverage: 24:345/394 of query aligns to 25:324/391 of 3ramA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
31% identity, 42% coverage: 193:357/394 of query aligns to 186:346/376 of 4o23A
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
31% identity, 42% coverage: 193:357/394 of query aligns to 186:346/375 of 4pqaA
Sites not aligning to the query:
>CA265_RS23900 CA265_RS23900 N-acyl-L-amino acid amidohydrolase
MIKNKIQELASNIFNDVVGYRQHIHANPELSFKEFETSLFIKDKLKKWGIEYTDCANTGV
VGLIKGNLPSDQVIALRADMDALPIHETNDKPYRSKNHGVMHACGHDVHTSSLLGTAHIL
NQLKDEFGGTIKLIFQPAEELLPGGASIMIKEGVLENPKPNAIVGQHVMPLIDAGKVGFR
SGIYMASTDELYVTVTGKGGHGAQPHQNIDPVLIASHIIVALQQIVSRNADPRLPSVLSF
GKVIANGATNVIPNEVKIEGTFRTLDENWRDEAHKRMKKMAEGMAESMGGSCDFDIHRGY
PFLINEEKLTANARAFAEDFLGKENVVDLDIWMAAEDFSFYSQVTDACFYRLGTGNAAKD
TQYSVHTPRFDIDEDALKISTGLMAYIALKQLGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory