Comparing CA265_RS23960 FitnessBrowser__Pedo557:CA265_RS23960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
46% identity, 100% coverage: 1:359/359 of query aligns to 1:357/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
46% identity, 100% coverage: 1:359/359 of query aligns to 1:357/362 of 1wopA
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
46% identity, 100% coverage: 1:359/359 of query aligns to 1:357/362 of 1wooA
Sites not aligning to the query:
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
38% identity, 100% coverage: 2:359/359 of query aligns to 2:357/363 of 3a8iA
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
34% identity, 99% coverage: 1:357/359 of query aligns to 33:394/403 of P48728
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
34% identity, 99% coverage: 1:357/359 of query aligns to 2:363/371 of 1wsvA
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 92% coverage: 29:357/359 of query aligns to 508:840/857 of Q63342
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
28% identity, 92% coverage: 29:357/359 of query aligns to 471:803/824 of 4pabB
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
29% identity, 92% coverage: 29:357/359 of query aligns to 515:847/866 of Q9UI17
Sites not aligning to the query:
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
25% identity, 97% coverage: 4:353/359 of query aligns to 577:946/965 of Q50LF0
Sites not aligning to the query:
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
25% identity, 97% coverage: 4:353/359 of query aligns to 576:945/963 of 3ad7A
Sites not aligning to the query:
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
25% identity, 97% coverage: 4:353/359 of query aligns to 576:945/963 of 1vrqA
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
26% identity, 93% coverage: 25:357/359 of query aligns to 37:368/369 of 3tfjA
Sites not aligning to the query:
3tfiA Dmsp-dependent demethylase from p. Ubique - with substrate dmsp (see paper)
26% identity, 93% coverage: 25:357/359 of query aligns to 37:368/369 of 3tfiA
Sites not aligning to the query:
Q4FP21 Dimethylsulfonioproprionate demethylase DmdA; EC 2.1.1.269 from Pelagibacter ubique (strain HTCC1062) (see paper)
26% identity, 93% coverage: 25:357/359 of query aligns to 37:368/369 of Q4FP21
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 97% coverage: 4:353/359 of query aligns to 577:946/965 of 2gagA
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
24% identity, 97% coverage: 4:353/359 of query aligns to 579:948/967 of Q46337
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
28% identity, 91% coverage: 34:358/359 of query aligns to 491:821/830 of Q9AGP8
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
28% identity, 91% coverage: 34:358/359 of query aligns to 488:818/827 of 1pj7A
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
28% identity, 91% coverage: 34:358/359 of query aligns to 489:819/828 of 1pj6A
Sites not aligning to the query:
>CA265_RS23960 FitnessBrowser__Pedo557:CA265_RS23960
MKNTALTEKHIALGAKMVPFAGYNMPVTYEGINAEHATVRNGVGVFDVSHMGEFILKGEN
ALDLIQRVTSNDAAKLYDGKVQYSCLPNKDGGIVDDLLVYKIDDKTYMLVVNASNIEKDW
NWIQQFNSKDVEMHNISDQTSLLAIQGPKAADALQTLTDVDLASMEYYTFVKGTFAGVDN
VVISATGYTGAGGFEIYFENQYADQIWDAIFKAGAPYNIQPIGLGARDTLRLEMGFCLYG
NDIDDSTSPIEAGLGWITKFSKSFTNSEALLAQKEAGIQKKLVGFEMIDRGIPRHDYEIA
DAEGNIIGKVTSGTQAPSLQKAIGMGYIAKDFTKEGTEVFILIRNTPIKAKVVKFPFYK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory