SitesBLAST
Comparing CA265_RS24650 FitnessBrowser__Pedo557:CA265_RS24650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D22), L9 (= L23), D10 (= D24), H20 (= H34), G46 (= G59), S114 (= S127), A115 (= A128), S116 (= S129), K117 (= K130), K145 (= K158)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/219 of 1z4nA
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (= H34), W24 (= W38), V47 (= V60), R49 (= R62), S116 (= S129), K117 (= K130), N118 (= N131)
- binding magnesium ion: D8 (= D22), D10 (= D24), E169 (= E182), D170 (= D183)
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/224 of 5olwA
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding calcium ion: D8 (= D22), D10 (= D24), P89 (= P102), V92 (= V105), E124 (= E137), N127 (≠ D140), E169 (= E182), D170 (= D183), S171 (≠ A184)
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
44% identity, 93% coverage: 16:228/228 of query aligns to 2:215/221 of P71447
- D8 (= D22) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D24) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (= T30) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (= H34) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (= K58) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G59) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (= R62) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (= S65) mutation to A: Wild-type activity.
- K76 (= K89) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D183) mutation to A: Impaired, but active with an increase in the affinity for G1P.
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/221 of 2wf9A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding beryllium trifluoride ion: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), A115 (= A128), K145 (= K158)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D24), H20 (= H34), G46 (= G59), V47 (= V60), R49 (= R62), S116 (= S129), K117 (= K130), N118 (= N131)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D24), H20 (= H34), G46 (= G59), V47 (= V60), R49 (= R62), A115 (= A128), S116 (= S129), K117 (= K130), N118 (= N131)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/221 of 1o03A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D22), L9 (= L23), D10 (= D24), H20 (= H34), G46 (= G59), V47 (= V60), R49 (= R62), S114 (= S127), A115 (= A128), S116 (= S129), K117 (= K130), K145 (= K158)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/221 of 1lvhA
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 4c4rA
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
- binding trifluoromagnesate: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), A115 (= A128), K145 (= K158)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D24), H20 (= H34), W24 (= W38), L44 (= L57), G46 (= G59), V47 (= V60), R49 (= R62), S52 (= S65), S116 (= S129), K117 (= K130)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 3zi4A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D24), H20 (= H34), G46 (= G59), V47 (= V60), R49 (= R62), S116 (= S129), K117 (= K130)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
- binding Scandium Tetrafluoride: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), A115 (= A128), K145 (= K158)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 2wf8A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding beryllium trifluoride ion: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), A115 (= A128), K145 (= K158)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D24), H20 (= H34), G46 (= G59), V47 (= V60), R49 (= R62), A115 (= A128), S116 (= S129), K117 (= K130)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D24), H20 (= H34), W24 (= W38), L44 (= L57), G46 (= G59), V47 (= V60), R49 (= R62), S52 (= S65), A115 (= A128), S116 (= S129), K117 (= K130)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 2wf7A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding tetrafluoroaluminate ion: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), K145 (= K158)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D24), G46 (= G59), V47 (= V60), R49 (= R62), S116 (= S129), K117 (= K130), N118 (= N131)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 2wf6A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding tetrafluoroaluminate ion: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), K145 (= K158)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D24), G46 (= G59), V47 (= V60), R49 (= R62), S116 (= S129), K117 (= K130)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
2wf5A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and trifluoromagnesate (see paper)
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 2wf5A
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D24), H20 (= H34), G46 (= G59), V47 (= V60), R49 (= R62), A115 (= A128), S116 (= S129)
- binding magnesium ion: D8 (= D22), D10 (= D24), D170 (= D183)
- binding trifluoromagnesate: D8 (= D22), L9 (= L23), D10 (= D24), S114 (= S127), A115 (= A128), K145 (= K158)
5ok0A Structure of the d10n mutant of beta-phosphoglucomutase from lactococcus lactis trapped with native reaction intermediate beta- glucose 1,6-bisphosphate to 2.2a resolution.
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 5ok0A
- active site: D8 (= D22), L9 (= L23), N10 (≠ D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding 1,6-di-O-phosphono-beta-D-glucopyranose: D8 (= D22), L9 (= L23), N10 (≠ D24), H20 (= H34), L44 (= L57), V47 (= V60), R49 (= R62), S114 (= S127), A115 (= A128), S116 (= S129)
- binding magnesium ion: D8 (= D22), N10 (≠ D24), D170 (= D183)
- binding 1,3-propandiol: I33 (≠ F47), N34 (≠ D48), G35 (≠ F49), V36 (≠ T50)
5o6rA Structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1-phosphate and aluminium tetrafluoride
43% identity, 93% coverage: 16:228/228 of query aligns to 2:215/218 of 5o6rA
- active site: D8 (= D22), L9 (= L23), N10 (≠ D24), T16 (= T30), K45 (= K58), S114 (= S127), A115 (= A128), K145 (= K158), E169 (= E182), D170 (= D183)
- binding tetrafluoroaluminate ion: D8 (= D22), L9 (= L23), N10 (≠ D24), G46 (= G59), S114 (= S127), K145 (= K158)
- binding magnesium ion: D8 (= D22), N10 (≠ D24), D170 (= D183)
- binding 1-O-phosphono-beta-D-glucopyranose: H20 (= H34), W24 (= W38), L44 (= L57), V47 (= V60), R49 (= R62), S52 (= S65), S116 (= S129), K117 (= K130), N118 (= N131)
4c4sA Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
44% identity, 93% coverage: 17:228/228 of query aligns to 3:212/215 of 4c4sA
- active site: D8 (= D22), L9 (= L23), D10 (= D24), T16 (= T30), K45 (= K58), S111 (= S127), A112 (= A128), K142 (= K158), E166 (= E182), D167 (= D183)
- binding (1R)-1,5-anhydro-1-[(S)-fluoro(phosphono)methyl]-D-glucitol: D10 (= D24), H20 (= H34), W24 (= W38), L44 (= L57), G46 (= G59), V47 (= V60), R49 (= R62), S113 (= S129)
- binding magnesium ion: D8 (= D22), D10 (= D24), D167 (= D183)
- binding trifluoromagnesate: D8 (= D22), L9 (= L23), D10 (= D24), S111 (= S127), A112 (= A128), K142 (= K158)
5o6pA Structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1,6-bisphosphate
46% identity, 82% coverage: 17:203/228 of query aligns to 2:189/209 of 5o6pA
- active site: D7 (= D22), L8 (= L23), N9 (≠ D24), T15 (= T30), K44 (= K58), S113 (= S127), A114 (= A128), K144 (= K158), E168 (= E182), D169 (= D183)
- binding 1,6-di-O-phosphono-beta-D-glucopyranose: D7 (= D22), L8 (= L23), N9 (≠ D24), H19 (= H34), L43 (= L57), K44 (= K58), G45 (= G59), V46 (= V60), R48 (= R62), S113 (= S127), A114 (= A128), S115 (= S129), K116 (= K130), K144 (= K158)
- binding magnesium ion: D7 (= D22), N9 (≠ D24), D169 (= D183)
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
39% identity, 91% coverage: 15:221/228 of query aligns to 3:209/227 of 4g9bA
- active site: D10 (= D22), L11 (= L23), D12 (= D24), T18 (= T30), K46 (= K58), S117 (= S127), V118 (≠ A128), K148 (= K158), E172 (= E182), D173 (= D183)
- binding magnesium ion: D10 (= D22), D12 (= D24), D173 (= D183)
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
25% identity, 93% coverage: 16:228/228 of query aligns to 1:220/223 of 6w04A
- active site: D7 (= D22), F8 (≠ L23), N9 (≠ D24), D15 (≠ T30), N44 (≠ K58), T109 (≠ S127), S110 (≠ A128), K144 (= K158), E168 (= E182), D169 (= D183)
- binding magnesium ion: D7 (= D22), N9 (≠ D24), D169 (= D183)
Query Sequence
>CA265_RS24650 FitnessBrowser__Pedo557:CA265_RS24650
MLEILPTSDSGLPTKIKACLFDLDGVLVDTAVYHYKAWKRLANTMGFDFTEEQNEQLKGV
SRVESLNKILAWGGIEKTDSEKDELAGLKNSWYVDMITKMTPAEVLPGTVDFLTAIHKAG
YKLALGSASKNSGIILEKTDLAHFFDKIVDGNMVTKSKPDPEVFLKGAELLGFAPDECVV
FEDAVAGVEAAKRGGMKAIGIGEKSVLTQADVVVSGLDKLTVKDLEEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory