Comparing CA265_RS24655 FitnessBrowser__Pedo557:CA265_RS24655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
1h54B Maltose phosphorylase from lactobacillus brevis (see paper)
48% identity, 97% coverage: 1:751/772 of query aligns to 1:743/754 of 1h54B
3wiqA Crystal structure of kojibiose phosphorylase complexed with kojibiose (see paper)
31% identity, 93% coverage: 26:740/772 of query aligns to 22:737/751 of 3wiqA
3wirA Crystal structure of kojibiose phosphorylase complexed with glucose (see paper)
31% identity, 93% coverage: 26:740/772 of query aligns to 22:737/756 of 3wirA
D6XZ22 1,2-alpha-glucosylglycerol phosphorylase; 2-O-alpha-glucosylglycerol phosphorylase; GGP; EC 2.4.1.332 from Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10) (see 2 papers)
28% identity, 95% coverage: 10:743/772 of query aligns to 14:735/761 of D6XZ22
4ktrA Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with isofagomine and glycerol (see paper)
28% identity, 95% coverage: 10:743/772 of query aligns to 14:735/762 of 4ktrA
4ktpA Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose (see paper)
28% identity, 95% coverage: 10:743/772 of query aligns to 14:735/767 of 4ktpA
4ktpB Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose (see paper)
28% identity, 95% coverage: 10:743/772 of query aligns to 14:735/761 of 4ktpB
8iucA Crystal structure of gh65 alpha-1,2-glucosidase from flavobacterium johnsoniae in complex with isomaltose (see paper)
26% identity, 66% coverage: 216:728/772 of query aligns to 183:655/659 of 8iucA
Sites not aligning to the query:
7fe4A Crystal structure of gh65 alpha-1,2-glucosidase from flavobacterium johnsoniae in complex with glucose (see paper)
26% identity, 66% coverage: 216:728/772 of query aligns to 183:655/659 of 7fe4A
Sites not aligning to the query:
Q32M88 Protein-glucosylgalactosylhydroxylysine glucosidase; Acid trehalase-like protein 1; EC 3.2.1.107 from Homo sapiens (Human) (see paper)
25% identity, 59% coverage: 292:743/772 of query aligns to 227:649/737 of Q32M88
P48016 Periplasmic acid trehalase ATH1; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
27% identity, 30% coverage: 280:512/772 of query aligns to 432:668/1211 of P48016
Sites not aligning to the query:
>CA265_RS24655 FitnessBrowser__Pedo557:CA265_RS24655
MKNYIKADEWNIIEEGFDPHLNKISESIFSLGNGRMGQRANFEETYTGETLPGNYVAGVY
YPDKTRVGWWKNGYPEYFAKVLNAANWIGIEVKLDGEILDLATAEVSDFKRVLNMHAGYL
ERTFTAKLKSGKTLKVKSTRFCSIADDEVGAIRYSITPLNFDGRLTLMPFIDGDVKNQDS
NYDEKFWDKVADEISGTEAYIKLRTKKTEFEVCTGSNIELYKNAEKLAINPEAVRKEKFV
GQTFSLEVKANEEISLVKIAANLSSENYPKESLLKETKSIIAKASAKGFDTLLKEQTEAW
ASKWEESDIIIEGDVSAQQAIRFNIFQLFQTYTGKDDRLNIGPKGFTGEKYGGSTYWDTE
AYCVPFYLATAPQEVSKNLLVYRHKQLGKAIENAAKLGFKDGAALYPMVTMNGEECHNEW
EITFEEIHRNGAIAFAIFNYIRYTGDESYLSDFGLEVLIGIARFWKQRVNWSNDKQQYVM
LGVTGPNEYENNVNNNWYTNILATWCMKYATEAAEIVKTQQPEKYNSLLKSLNFDQKEFA
DWADIIEKMYYPQDEKLGIFLQQDGYLDKEQTLVKDLPASERPINQKWSWDRILRSCFIK
QADVLQGLYFFEEDYDLDTLKRNFDFYEPRTVHESSLSPCVHSILAAKLNDEARAYEFYL
RTARLDLDDYNNDTEDGLHITSMAGTWMSVVEGFAGMRVREGKLQFNPFLPGKWKSFSFT
IGFRGATLKINITESGISIKNNAAVDLEIGIRNQLYKLAGNTEIEVNNAELV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory