Comparing CA265_RS24855 FitnessBrowser__Pedo557:CA265_RS24855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 69% coverage: 50:210/234 of query aligns to 127:280/308 of O33341
Sites not aligning to the query:
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
34% identity, 89% coverage: 1:209/234 of query aligns to 6:228/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
33% identity, 87% coverage: 6:209/234 of query aligns to 5:222/249 of 7d53A
3fijA Crystal structure of a uncharacterized protein lin1909
34% identity, 80% coverage: 42:228/234 of query aligns to 37:218/224 of 3fijA
7d4rB Spua native structure (see paper)
43% identity, 49% coverage: 96:209/234 of query aligns to 73:190/215 of 7d4rB
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
28% identity, 80% coverage: 44:231/234 of query aligns to 57:243/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
28% identity, 80% coverage: 44:231/234 of query aligns to 59:245/254 of P76038
>CA265_RS24855 FitnessBrowser__Pedo557:CA265_RS24855
MSDKIIIGVSDCSKFDIYRDWVLSYNKSVEVIQLGYKLNNFEEIKKCDGIVLTGGEDVHP
RFYNHPEYYPYCYEDDIDEKRDEFEFKVLTYTEAHSVPVLGICRGMQVGNVFFGGTLIPD
IPTWGKFDHSKMHDKSDRYHEIMVNPSSWLNQIVNTDKGLVNSNHHQSTDKTGKGLVVSA
ISPDGVTEAMERIEPEGKSFLLFVQWHPERLKNQQGPFSKNIHDAFINSIRING
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory