Comparing CA265_RS25075 FitnessBrowser__Pedo557:CA265_RS25075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
28% identity, 57% coverage: 34:232/348 of query aligns to 45:239/243 of 2eixA
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
27% identity, 64% coverage: 18:238/348 of query aligns to 169:390/396 of 1gvhA
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 64% coverage: 18:238/348 of query aligns to 169:390/396 of P24232
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
31% identity, 60% coverage: 31:238/348 of query aligns to 34:235/237 of 4eh1A
3b2gA Leptolyngbya boryana ferredoxin (see paper)
44% identity, 21% coverage: 274:346/348 of query aligns to 18:90/98 of 3b2gA
1cnfA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
35% identity, 30% coverage: 109:212/348 of query aligns to 127:234/260 of 1cnfA
Sites not aligning to the query:
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
42% identity, 24% coverage: 260:342/348 of query aligns to 2:86/97 of 1rfkB
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
48% identity, 19% coverage: 282:346/348 of query aligns to 25:89/97 of 7s3dX
P17571 Nitrate reductase [NADH] 1; NR; EC 1.7.1.1 from Zea mays (Maize) (see 3 papers)
35% identity, 29% coverage: 111:212/348 of query aligns to 490:595/621 of P17571
Sites not aligning to the query:
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
43% identity, 23% coverage: 260:339/348 of query aligns to 2:82/97 of 7fixR1
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
43% identity, 23% coverage: 260:339/348 of query aligns to 3:83/98 of 6khi1
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 43% coverage: 64:212/348 of query aligns to 112:257/281 of Q9ZNT1
Sites not aligning to the query:
P27320 Ferredoxin-1; Ferredoxin I from Synechocystis sp. (strain PCC 6803 / Kazusa) (see 3 papers)
48% identity, 18% coverage: 282:344/348 of query aligns to 25:87/97 of P27320
Sites not aligning to the query:
5aukA Crystal structure of the ga-substituted ferredoxin (see paper)
48% identity, 18% coverage: 282:344/348 of query aligns to 24:86/96 of 5aukA
2kajA Nmr structure of gallium substituted ferredoxin (see paper)
48% identity, 18% coverage: 282:344/348 of query aligns to 24:86/96 of 2kajA
1doxA 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. Pcc 6803 (see paper)
48% identity, 18% coverage: 282:344/348 of query aligns to 24:86/96 of 1doxA
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
25% identity, 89% coverage: 27:335/348 of query aligns to 466:739/753 of 6laaA
Sites not aligning to the query:
4fxcA Tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis (see paper)
46% identity, 18% coverage: 282:344/348 of query aligns to 26:88/98 of 4fxcA
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
39% identity, 24% coverage: 260:342/348 of query aligns to 3:87/99 of P0A3C7
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
39% identity, 24% coverage: 260:342/348 of query aligns to 2:86/98 of 1ewyC
>CA265_RS25075 FitnessBrowser__Pedo557:CA265_RS25075
MFKLRINKIINQPGDNITFQFEEVDEPYPKYLAGQFISLIFQGKHKEIRRSYSFNSSPDV
DEPLSITVKRVENGEISRFLHHKTSVNDILLAQEPQGMFSYLPDENLERDLFLFAAGVGI
TPLFSILKTALVREKKSLVTLVYSNRSMEDALFYDELSEWQKKYPERLKIVWVFSNSKNL
MTARLNKFYIEKLLKEHLHFDRNDALFYSCGPIIYMDLCRITLLGVGFDIKQIKRETFVL
PEDEVDEDDGSAEKVVDKNTYSVVLNFKGEIYHLDVPWPKRILDVALENKIKLPYSCRGG
VCSTCVANCTKGGVRMDYNEVLTDDELERGRVLVCTGHPTENGTTIAW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory