Comparing CA265_RS25090 FitnessBrowser__Pedo557:CA265_RS25090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
43% identity, 99% coverage: 4:339/339 of query aligns to 6:337/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
44% identity, 99% coverage: 4:339/339 of query aligns to 13:336/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
43% identity, 99% coverage: 4:337/339 of query aligns to 4:323/324 of 2himA
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
41% identity, 99% coverage: 4:337/339 of query aligns to 4:352/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
41% identity, 99% coverage: 4:337/339 of query aligns to 4:352/357 of 5dndD
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
41% identity, 99% coverage: 3:337/339 of query aligns to 3:300/301 of 7r6bB
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
38% identity, 83% coverage: 55:337/339 of query aligns to 52:326/328 of 5ot0A
Sites not aligning to the query:
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
35% identity, 99% coverage: 1:336/339 of query aligns to 1:325/327 of 4q0mA
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
35% identity, 99% coverage: 3:336/339 of query aligns to 2:324/326 of Q8TZE8
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
31% identity, 99% coverage: 1:337/339 of query aligns to 90:427/437 of 1zq1A
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
36% identity, 54% coverage: 3:184/339 of query aligns to 2:173/175 of 5b5uA
Sites not aligning to the query:
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
36% identity, 54% coverage: 3:184/339 of query aligns to 2:173/182 of 4njeA
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
26% identity, 82% coverage: 1:279/339 of query aligns to 1:257/306 of 7r5qA
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
27% identity, 66% coverage: 57:279/339 of query aligns to 58:277/326 of 1ho3A
Sites not aligning to the query:
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
27% identity, 66% coverage: 57:279/339 of query aligns to 80:299/348 of P00805
Sites not aligning to the query:
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
26% identity, 82% coverage: 1:279/339 of query aligns to 1:258/307 of 1jazA
Sites not aligning to the query:
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
26% identity, 68% coverage: 55:283/339 of query aligns to 54:282/326 of 2wltA
Sites not aligning to the query:
P38986 L-asparaginase 1; L-asparaginase I; L-asparagine amidohydrolase I; ASP I; EC 3.5.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 73% coverage: 1:248/339 of query aligns to 53:301/381 of P38986
6pa3A E. Coli l-asparaginase ii double mutant (t89v,k162t) in complex with l-asn at ph 7.0 (see paper)
27% identity, 66% coverage: 57:279/339 of query aligns to 66:285/334 of 6pa3A
Sites not aligning to the query:
6wywA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-asp at ph 4.5
25% identity, 84% coverage: 1:286/339 of query aligns to 1:274/317 of 6wywA
>CA265_RS25090 FitnessBrowser__Pedo557:CA265_RS25090
MTKILIIYTGGTIGMVNDPTNGMLIPFDFQQIKENVPELSRLDYDLDVHSFNPVLDSSNM
DPEIWKTLAELVYHKYDAYDGFVILHGSDTMAFTASALSFMLENLAKPVVLTGSQLPIGE
IRTDAKENLITALEIAATKEDGKALFPEVCIYFDAQLFRGNRSIKYNSEKFEAFRSPNYP
ILAEAGVHLQFHRNYILKATEGELKLHTNFNSNIGVLKLYPGITPQAVQAITDSKVDAII
LETFGSGNTTTAQWFLDSLRQAILNGKIIIDISQCKKGSVQLGRYETSRELLKMGILSGY
DLTFEATVTKLMFVMGLGLSIEESRKLMEESLRGELTKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory