SitesBLAST
Comparing CA265_RS25425 FitnessBrowser__Pedo557:CA265_RS25425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
53% identity, 90% coverage: 16:322/342 of query aligns to 88:392/420 of Q8NBZ7
- G98 (= G26) binding
- F99 (= F27) binding
- V100 (≠ L28) binding
- D119 (= D47) binding
- N120 (= N48) binding
- F122 (≠ I50) binding
- T123 (= T51) binding
- G124 (= G52) binding
- D144 (= D72) binding
- V145 (= V73) binding
- L149 (≠ V77) binding
- Y150 (≠ H78) binding
- L159 (≠ F89) binding
- S161 (= S91) binding
- K177 (= K107) binding
- T178 (≠ V108) binding
- N185 (= N115) binding
- G188 (= G118) binding
- K191 (≠ R121) binding
- R192 (≠ N122) binding
- A200 (= A130) binding
- E204 (= E134) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y161) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K165) binding
- R236 (= R166) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y175) binding
- Q248 (≠ F178) binding
- E249 (≠ H179) binding
- T261 (= T191) binding
- H267 (≠ R197) binding
- R272 (= R202) binding
- R361 (= R291) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
53% identity, 90% coverage: 16:322/342 of query aligns to 1:305/312 of 2b69A
- active site: T115 (= T132), S116 (= S133), E117 (= E134), Y144 (= Y161), K148 (= K165), R185 (= R202)
- binding nicotinamide-adenine-dinucleotide: G8 (= G23), G11 (= G26), F12 (= F27), V13 (≠ L28), D32 (= D47), N33 (= N48), T36 (= T51), G37 (= G52), D57 (= D72), V58 (= V73), L72 (≠ F89), A73 (= A90), S74 (= S91), A76 (= A93), T91 (≠ V108), T115 (= T132), Y144 (= Y161), K148 (= K165), I171 (= I188), N173 (= N190), R185 (= R202)
- binding uridine-5'-diphosphate: P61 (≠ F76), L62 (≠ V77), Y63 (≠ H78), P78 (= P95), N98 (= N115), G101 (= G118), L102 (= L119), K104 (≠ R121), R105 (≠ N122), Y158 (= Y175), N173 (= N190), R185 (= R202), V186 (= V203), N189 (≠ A206), T201 (= T218), Y203 (≠ F220), Q208 (= Q225), R210 (= R227), I244 (= I261), D270 (= D287)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
54% identity, 89% coverage: 16:321/342 of query aligns to 86:389/418 of Q6GMI9
- R234 (= R166) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
46% identity, 90% coverage: 16:322/342 of query aligns to 1:267/274 of 4lk3B
- active site: T112 (= T132), S113 (= S133), E114 (= E134), K119 (= K165), R156 (= R202)
- binding nicotinamide-adenine-dinucleotide: G8 (= G23), G11 (= G26), F12 (= F27), V13 (≠ L28), D32 (= D47), N33 (= N48), T36 (= T51), G37 (= G52), D57 (= D72), V58 (= V73), L72 (≠ F89), A73 (= A90), S74 (= S91), P75 (= P92), T88 (≠ V108), A110 (= A130), T112 (= T132), K119 (= K165), I142 (= I188), H151 (≠ R197)
- binding uridine-5'-diphosphate: R156 (= R202), V157 (= V203), N160 (≠ A206), T172 (= T218), Y174 (≠ F220), Q179 (= Q225), R181 (= R227), I215 (= I261)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (≠ F76), L62 (≠ V77), Y63 (≠ H78), I83 (= I103), K87 (= K107), N95 (= N115), G98 (= G118), L99 (= L119), K101 (≠ R121), Y129 (= Y175), E133 (≠ H179)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
45% identity, 90% coverage: 16:322/342 of query aligns to 1:264/271 of 4lk3C
- active site: T110 (= T132), S111 (= S133), E112 (= E134), K117 (= K165), R154 (= R202)
- binding nicotinamide-adenine-dinucleotide: G8 (= G23), G11 (= G26), F12 (= F27), V13 (≠ L28), D32 (= D47), N33 (= N48), T36 (= T51), G37 (= G52), D57 (= D72), V58 (= V73), L72 (≠ F89), A73 (= A90), S74 (= S91), P75 (= P92), T86 (≠ V108), K117 (= K165), I140 (= I188), H149 (≠ R197)
- binding pyrophosphate 2-: R154 (= R202), V155 (= V203)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (≠ F76), L62 (≠ V77), Y63 (≠ H78), N93 (= N115), G96 (= G118), L97 (= L119), K99 (≠ R121), R100 (≠ N122), Y127 (= Y175), E131 (≠ H179)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
32% identity, 89% coverage: 19:322/342 of query aligns to 3:305/309 of 4zrnA
- active site: T117 (≠ S133), G119 (vs. gap), A120 (≠ E134), Y143 (≠ R158), K147 (= K165), Y181 (≠ L198), G185 (≠ R202)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D31 (= D47), N32 (= N48), S34 (≠ I50), S35 (≠ T51), G36 (= G52), S51 (≠ N65), I52 (≠ F66), L73 (≠ F89), A74 (= A90), A75 (≠ S91), T92 (≠ V108), S115 (= S131), S116 (≠ T132), Y143 (≠ R158), K147 (= K165), Y170 (≠ I188), V173 (≠ T191)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S133), G119 (vs. gap), A120 (≠ E134), Y143 (≠ R158), N172 (= N190), G185 (≠ R202), V186 (= V203), H201 (≠ T218), F203 (= F220), Y208 (≠ Q225), R210 (= R227), V244 (≠ I261), R267 (≠ P284), D270 (= D287)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
33% identity, 90% coverage: 18:324/342 of query aligns to 2:313/321 of 6zllA
- active site: T126 (= T132), S127 (= S133), S128 (≠ E134), Y149 (≠ R158), K153 (= K165)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D32 (= D47), H33 (≠ N48), F34 (≠ L49), I35 (= I50), K43 (≠ D53), D62 (vs. gap), I63 (vs. gap), L81 (≠ F89), A82 (= A90), A83 (≠ S91), I124 (≠ A130), T126 (= T132), Y149 (≠ R158), K153 (= K165), Y176 (≠ I188), V179 (≠ T191), R185 (= R197), M188 (≠ R202)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P92), V87 (≠ S94), R88 (≠ P95), T126 (= T132), S127 (= S133), Y149 (≠ R158), T178 (≠ N190), R185 (= R197), A189 (≠ V203), R192 (≠ A206), T204 (= T218), F206 (= F220), Q211 (= Q225), R213 (= R227), I250 (= I261), E276 (≠ D287)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
32% identity, 90% coverage: 17:323/342 of query aligns to 8:313/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G23), G17 (= G26), F18 (= F27), I19 (≠ L28), D37 (= D47), N38 (= N48), E40 (≠ H59), R41 (≠ L60), N61 (vs. gap), V62 (vs. gap), A81 (≠ F89), A82 (= A90), A83 (≠ S91), F124 (≠ A130), K154 (= K165), P177 (≠ I188), N179 (= N190)
- binding uridine-5'-diphosphate: R147 (= R158), G189 (= G201), A190 (≠ R202), M194 (≠ F207), Y205 (≠ T218), I206 (= I219), F207 (= F220), R214 (= R227), I251 (= I261)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
33% identity, 90% coverage: 18:324/342 of query aligns to 2:313/314 of 6zldA
- active site: T126 (= T132), S127 (= S133), S128 (≠ E134), Y149 (≠ R158), K153 (= K165)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D32 (= D47), H33 (≠ N48), F34 (≠ L49), I35 (= I50), K43 (≠ D53), D62 (vs. gap), I63 (vs. gap), L81 (≠ F89), A82 (= A90), A83 (≠ S91), I124 (≠ A130), T126 (= T132), K153 (= K165), Y176 (≠ I188), T178 (≠ N190), R185 (= R197), M188 (≠ R202)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P92), R88 (≠ P95), T126 (= T132), S127 (= S133), S128 (≠ E134), Y149 (≠ R158), F177 (= F189), T178 (≠ N190), R185 (= R197), M188 (≠ R202), A189 (≠ V203), R192 (≠ A206), T204 (= T218), F206 (= F220), Q211 (= Q225), R213 (= R227), I250 (= I261), E276 (≠ D287)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
33% identity, 90% coverage: 18:324/342 of query aligns to 2:313/314 of 6zl6A
- active site: T126 (= T132), S127 (= S133), S128 (≠ E134), Y149 (≠ R158), K153 (= K165)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D32 (= D47), H33 (≠ N48), F34 (≠ L49), I35 (= I50), K43 (≠ D53), D62 (vs. gap), I63 (vs. gap), L81 (≠ F89), A82 (= A90), A83 (≠ S91), I124 (≠ A130), T126 (= T132), K153 (= K165), Y176 (≠ I188), T178 (≠ N190), V179 (≠ T191), R185 (= R197), M188 (≠ R202)
- binding uridine-5'-diphosphate: T178 (≠ N190), A189 (≠ V203), R192 (≠ A206), T204 (= T218), F206 (= F220), Q211 (= Q225), R213 (= R227), I250 (= I261), E276 (≠ D287)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
33% identity, 90% coverage: 18:324/342 of query aligns to 2:313/314 of 6zljA
- active site: T126 (= T132), S127 (= S133), S128 (≠ E134), F149 (≠ R158), K153 (= K165)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D32 (= D47), H33 (≠ N48), F34 (≠ L49), I35 (= I50), K43 (≠ D53), D62 (vs. gap), I63 (vs. gap), L81 (≠ F89), A82 (= A90), A83 (≠ S91), I124 (≠ A130), T126 (= T132), K153 (= K165), Y176 (≠ I188), T178 (≠ N190), V179 (≠ T191), R185 (= R197), M188 (≠ R202)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P92), R88 (≠ P95), T126 (= T132), S127 (= S133), S128 (≠ E134), F149 (≠ R158), F177 (= F189), T178 (≠ N190), R185 (= R197), M188 (≠ R202), A189 (≠ V203), R192 (≠ A206), T204 (= T218), F206 (= F220), Q211 (= Q225), R213 (= R227), I250 (= I261), E276 (≠ D287)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
29% identity, 90% coverage: 18:324/342 of query aligns to 2:312/313 of 6bwlA
- active site: T122 (= T132), C123 (≠ S133), M124 (≠ E134), Y147 (= Y161), K151 (= K165)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D31 (= D47), N32 (= N48), L33 (= L49), N35 (≠ T51), S36 (≠ G52), D57 (≠ K82), I58 (≠ L83), L79 (≠ F89), A80 (= A90), A81 (≠ S91), I83 (≠ A93), M120 (≠ A130), K151 (= K165), N176 (= N190), T177 (= T191)
- binding uridine-5'-diphosphate: N176 (= N190), G189 (≠ R202), V190 (= V203), N205 (≠ T218), I206 (= I219), Y207 (≠ F220), Q212 (= Q225), R214 (= R227), I250 (= I261), E275 (≠ D287)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 93% coverage: 3:321/342 of query aligns to 3:331/336 of 3ruhA
- active site: S142 (≠ T132), S143 (= S133), S144 (≠ E134), Y166 (≠ R158), K170 (= K165), N204 (= N199)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (≠ L28), D47 (= D47), N48 (= N48), S50 (≠ I50), T51 (= T51), G52 (= G52), D78 (≠ K82), I79 (≠ L83), Q98 (≠ F89), A99 (= A90), A100 (≠ S91), T117 (≠ V108), A140 (= A130), A141 (≠ S131), S142 (≠ T132), Y166 (≠ R158), K170 (= K165), Y193 (≠ I188), V196 (≠ T191)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A93), S103 (= S94), S142 (≠ T132), S143 (= S133), S144 (≠ E134), Y166 (≠ R158), Y193 (≠ I188), N195 (= N190), A209 (≠ R202), V210 (= V203), K213 (≠ A206), W214 (≠ F207), Y225 (≠ T218), I226 (= I219), N227 (≠ F220), R234 (= R227), L271 (≠ I261), R294 (≠ P284), D297 (= D287), V298 (≠ P288), S301 (≠ R291)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 93% coverage: 3:321/342 of query aligns to 3:331/336 of 3rufA
- active site: S142 (≠ T132), S143 (= S133), S144 (≠ E134), Y166 (≠ R158), K170 (= K165), N204 (= N199)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (≠ L28), D47 (= D47), N48 (= N48), S50 (≠ I50), T51 (= T51), G52 (= G52), D78 (≠ K82), I79 (≠ L83), Q98 (≠ F89), A99 (= A90), A100 (≠ S91), T117 (≠ V108), A140 (= A130), Y166 (≠ R158), K170 (= K165), Y193 (≠ I188), V196 (≠ T191)
- binding uridine-5'-diphosphate: N195 (= N190), A209 (≠ R202), V210 (= V203), K213 (≠ A206), W214 (≠ F207), Y225 (≠ T218), I226 (= I219), N227 (≠ F220), R234 (= R227), L271 (≠ I261), R294 (≠ P284), D297 (= D287)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
30% identity, 93% coverage: 3:321/342 of query aligns to 3:331/336 of 3lu1A
- active site: S142 (≠ T132), S143 (= S133), S144 (≠ E134), Y166 (≠ R158), K170 (= K165), N204 (= N199)
- binding glycine: Q135 (≠ R126), K187 (≠ E182)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (≠ L28), D47 (= D47), N48 (= N48), S50 (≠ I50), T51 (= T51), G52 (= G52), D78 (≠ K82), I79 (≠ L83), Q98 (≠ F89), A99 (= A90), A100 (≠ S91), A140 (= A130), A141 (≠ S131), S142 (≠ T132), Y166 (≠ R158), K170 (= K165), Y193 (≠ I188), N195 (= N190)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S94), S142 (≠ T132), S143 (= S133), S144 (≠ E134), Y166 (≠ R158), N195 (= N190), V210 (= V203), W214 (≠ F207), Y225 (≠ T218), I226 (= I219), N227 (≠ F220), R234 (= R227), L271 (≠ I261), R294 (≠ P284), D297 (= D287)
2c59A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site. (see paper)
29% identity, 94% coverage: 3:322/342 of query aligns to 7:326/364 of 2c59A
- active site: S132 (≠ T132), A133 (≠ S133), C134 (≠ E134), Y163 (= Y161), K167 (= K165), K206 (vs. gap)
- binding guanosine-5'-diphosphate-beta-l-galactose: M91 (≠ A93), G92 (≠ S94), G93 (≠ P95), M94 (≠ I96), S132 (≠ T132), C134 (≠ E134), H191 (≠ F189), N192 (= N190), K206 (vs. gap), A207 (≠ V203), A210 (= A206), F211 (= F207), K214 (≠ Q210), W225 (≠ F220), Q230 (= Q225), R232 (= R227), M266 (≠ I261), P289 (vs. gap), E290 (≠ D286)
- binding guanosine-5'-diphosphate-alpha-d-mannose: G92 (≠ S94), M94 (≠ I96), I97 (≠ L99), S132 (≠ T132), C134 (≠ E134), Y163 (= Y161), N192 (= N190), K206 (vs. gap), A207 (≠ V203), A210 (= A206), F211 (= F207), K214 (≠ Q210), W225 (≠ F220), Q230 (= Q225), R232 (= R227), M266 (≠ I261), P289 (vs. gap), E290 (≠ D286), R295 (= R291)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (≠ L28), D47 (= D47), W48 (vs. gap), K49 (vs. gap), D67 (≠ K62), L68 (= L63), L87 (≠ F89), A89 (≠ S91), M91 (≠ A93), I111 (≠ G112), A130 (= A130), S132 (≠ T132), Y163 (= Y161), K167 (= K165), F190 (≠ I188), N192 (= N190), I193 (≠ T191), K206 (vs. gap)
Sites not aligning to the query:
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 94% coverage: 3:322/342 of query aligns to 18:337/377 of Q93VR3
- 34:60 (vs. 23:47, 44% identical) binding
- D58 (= D47) binding
- D78 (≠ K62) binding
- C145 (≠ E134) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y161) binding ; mutation to F: Loss of activity.
- K178 (= K165) binding ; mutation to R: Strong reduction of activity.
- K217 (vs. gap) mutation to A: Loss of activity.
- R306 (= R291) mutation to A: Strong reduction of activity.
2c54A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),k178r, with gdp- beta-l-gulose and gdp-4-keto-beta-l-gulose bound in active site. (see paper)
28% identity, 94% coverage: 3:322/342 of query aligns to 6:325/362 of 2c54A
- active site: S131 (≠ T132), A132 (≠ S133), C133 (≠ E134), Y162 (= Y161), R166 (≠ K165), K205 (vs. gap)
- binding guanosine 5'-diphosphate-4-keto-beta-l-gulose: G91 (≠ S94), G92 (≠ P95), M93 (≠ I96), S131 (≠ T132), H190 (≠ F189), N191 (= N190), K205 (vs. gap), A206 (≠ V203), A209 (= A206), F210 (= F207), K213 (≠ Q210), W224 (≠ F220), Q229 (= Q225), R231 (= R227), M265 (≠ I261), P288 (vs. gap), E289 (≠ D286)
- binding guanosine 5'-diphosphate-beta-l-gulose: G91 (≠ S94), G92 (≠ P95), M93 (≠ I96), S131 (≠ T132), C133 (≠ E134), Y162 (= Y161), H190 (≠ F189), N191 (= N190), K205 (vs. gap), A206 (≠ V203), A209 (= A206), F210 (= F207), K213 (≠ Q210), W224 (≠ F220), Q229 (= Q225), R231 (= R227), M265 (≠ I261), P288 (vs. gap), E289 (≠ D286)
- binding nicotinamide-adenine-dinucleotide: G22 (= G23), G25 (= G26), F26 (= F27), I27 (≠ L28), D46 (= D47), W47 (vs. gap), K48 (vs. gap), V65 (≠ F61), D66 (≠ K62), L67 (= L63), L86 (≠ F89), A88 (≠ S91), M90 (≠ A93), I110 (≠ G112), A129 (= A130), S131 (≠ T132), Y162 (= Y161), R166 (≠ K165), F189 (≠ I188), N191 (= N190), I192 (≠ T191), K205 (vs. gap)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
32% identity, 88% coverage: 18:319/342 of query aligns to 2:298/304 of 3aw9A
- active site: A105 (= A130), S107 (≠ T132), S108 (= S133), T109 (≠ E134), Y131 (= Y161), K135 (= K165), L166 (≠ M196), G169 (≠ N199)
- binding galactose-uridine-5'-diphosphate: P69 (= P95), V71 (≠ D97), S107 (≠ T132), Y131 (= Y161), N160 (= N190), H168 (≠ L198), V170 (= V203), D173 (≠ A206), L188 (≠ F220), Q193 (= Q225), K195 (≠ R227), Y197 (≠ F229), V234 (≠ I261), W263 (vs. gap), D266 (= D287)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (≠ L28), D31 (= D47), I32 (≠ N48), R46 (≠ F61), D47 (≠ K62), L48 (= L63), F65 (= F89), A66 (= A90), A67 (= A93), E82 (≠ V108), A105 (= A130), S106 (= S131), Y131 (= Y161), K135 (= K165), Y158 (≠ I188), N160 (= N190), V161 (≠ T191), H168 (≠ L198)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
30% identity, 93% coverage: 3:321/342 of query aligns to 6:339/345 of Q7BJX9
- GVAGFI 26:31 (≠ GAAGFL 23:28) binding
- DNFSTG 50:55 (≠ DNLITG 47:52) binding
- DI 81:82 (≠ KL 82:83) binding
- QAA 101:103 (≠ FAS 89:91) binding
- T120 (≠ V108) binding
- SS 145:146 (≠ TS 132:133) binding
- S147 (≠ E134) mutation to T: No effect on epimerase activity.
- Y169 (≠ R158) binding
- K173 (= K165) binding
- YFN 196:198 (≠ IFN 188:190) binding
- V199 (≠ T191) binding
- VIPK 213:216 (≠ VLPA 203:206) binding
- YIN 228:230 (≠ TIF 218:220) binding
- S236 (≠ T226) mutation to G: No effect on epimerase activity.
- R237 (= R227) binding
- R271 (≠ E258) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ PQDD 284:287) binding
- R307 (≠ K289) mutation to A: No effect on epimerase activity.
- H308 (≠ Q290) mutation to A: No effect on epimerase activity.
- S309 (≠ R291) mutation to Y: Abolishes epimerase activity.
Query Sequence
>CA265_RS25425 FitnessBrowser__Pedo557:CA265_RS25425
MNERKEKSPSGDVGAKKRILITGAAGFLGSHLCDRFVKEGYHVIGMDNLITGDMANIEHL
FKLENFEFYNHDVSKFVHIPGKLHYILHFASPASPIDYLKIPIQTLKVGSLGTHNLLGLA
RNKNARMLIASTSEVYGDPNVNPQPEEYWGNVNPVGPRGVYDEAKRFQEAITMAYHTFHG
VETRIVRIFNTYGPRMRLNDGRVLPAFIGQALRGEDLTIFGDGSQTRSFCYVDDLIEGIY
RLLMSDYAQPVNIGNPDEITIKQFCEEIIKLTGTTQKIVYKELPQDDPKQRRPDITKART
ILGWEPKVGRAEGLKITYEYFKSLPAEALEKIDHKDFTTFNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory