SitesBLAST
Comparing CCNA_00003 FitnessBrowser__Caulo:CCNA_00003 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
37% identity, 93% coverage: 1:265/285 of query aligns to 1:252/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ I70), G130 (= G136), G133 (= G139), A134 (= A140), N153 (= N160), R154 (= R161), T155 (= T162), K158 (≠ R165), T188 (= T199), S189 (= S200), V190 (≠ L201), I214 (≠ M225), M238 (= M251), L239 (= L252)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S22), S21 (= S24), N64 (= N67), T66 (= T69), K70 (= K73), N91 (= N94), D106 (= D110), Y216 (= Y227), L239 (= L252), Q242 (= Q255)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
37% identity, 93% coverage: 1:265/285 of query aligns to 1:252/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ I70), G132 (= G138), G133 (= G139), A134 (= A140), N153 (= N160), R154 (= R161), T155 (= T162), T188 (= T199), S189 (= S200), V190 (≠ L201)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S22), S21 (= S24), N64 (= N67), K70 (= K73), N91 (= N94), D106 (= D110), Y216 (= Y227), L239 (= L252), Q242 (= Q255)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
37% identity, 93% coverage: 1:265/285 of query aligns to 1:252/269 of O67049
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
33% identity, 95% coverage: 1:270/285 of query aligns to 5:282/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G136), A138 (= A137), G139 (= G138), G140 (= G139), A141 (= A140), N161 (= N160), R162 (= R161), D164 (vs. gap), F166 (vs. gap), T210 (= T199), G211 (≠ S200), V212 (≠ L201), M214 (≠ L203), F217 (≠ G206), V238 (≠ M225), Y240 (= Y227), G261 (= G248), M264 (= M251), M265 (≠ L252)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
33% identity, 95% coverage: 1:270/285 of query aligns to 5:282/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
33% identity, 95% coverage: 1:270/285 of query aligns to 2:279/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ I70), G134 (= G136), A135 (= A137), G136 (= G138), G137 (= G139), A138 (= A140), N158 (= N160), R159 (= R161), D161 (vs. gap), F163 (vs. gap), T207 (= T199), V209 (≠ L201), M211 (≠ L203), F214 (≠ G206), V235 (≠ M225), Y237 (= Y227), M261 (= M251), M262 (≠ L252)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S22), S25 (= S24), N68 (= N67), S70 (≠ T69), K74 (= K73), N95 (= N94), D110 (= D110), Q265 (= Q255)
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
37% identity, 95% coverage: 14:283/285 of query aligns to 10:276/278 of Q9KVT3
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
37% identity, 95% coverage: 14:283/285 of query aligns to 6:272/272 of 3pgjA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S14 (= S22), S16 (= S24), N59 (= N67), T61 (= T69), K65 (= K73), N86 (= N94), D102 (= D110), Q244 (= Q255)
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
30% identity, 95% coverage: 14:285/285 of query aligns to 5:269/269 of Q5HNV1
- SLS 13:15 (≠ SMS 22:24) binding
- T60 (= T69) binding
- N85 (= N94) binding
- D100 (= D110) binding
- Y211 (= Y227) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q255) binding
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
37% identity, 94% coverage: 14:281/285 of query aligns to 6:270/271 of 1nytA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K65 (= K73), D102 (= D110), G128 (= G138), G129 (= G139), A130 (= A140), N149 (= N160), R150 (= R161), T151 (= T162), R154 (= R165), T188 (= T199), S189 (= S200), S190 (≠ L201), M213 (= M225), G237 (= G248), M240 (= M251), L241 (= L252)
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
37% identity, 94% coverage: 14:281/285 of query aligns to 6:270/272 of P15770
P43876 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
36% identity, 89% coverage: 14:268/285 of query aligns to 6:258/272 of P43876
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
38% identity, 95% coverage: 14:283/285 of query aligns to 6:268/268 of 3sefA
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
32% identity, 89% coverage: 13:266/285 of query aligns to 5:267/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (= A137), G127 (= G138), G128 (= G139), A129 (= A140), R150 (vs. gap), F154 (vs. gap), K199 (≠ S200), V200 (≠ L201), M202 (≠ L203), C226 (≠ M225), Y228 (= Y227), M252 (= M251), L253 (= L252)
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
30% identity, 95% coverage: 14:283/285 of query aligns to 5:258/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (= S22), S15 (= S24), N58 (= N67), T60 (= T69), K64 (= K73), N85 (= N94), D100 (= D110), F227 (≠ L252), Q230 (= Q255)
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
32% identity, 89% coverage: 13:266/285 of query aligns to 11:273/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (= A137), G133 (= G138), G134 (= G139), A135 (= A140), N155 (vs. gap), R156 (vs. gap), D158 (vs. gap), F160 (vs. gap), T204 (= T199), K205 (≠ S200), V206 (≠ L201), M208 (≠ L203), C232 (≠ M225), M258 (= M251), L259 (= L252)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
32% identity, 89% coverage: 13:266/285 of query aligns to 11:273/288 of P0A6D5
- S22 (= S24) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (= Y41) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T69) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K73) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N94) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (= T109) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D110) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (= AGGA 137:140) binding
- NRRD 155:158 (vs. gap) binding
- K205 (≠ S200) binding
- CVYN 232:235 (≠ MVYK 225:228) binding
- G255 (= G248) binding
- Q262 (= Q255) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 95% coverage: 1:272/285 of query aligns to 6:276/287 of 1nvtB
- active site: K75 (= K73), D111 (= D110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (= I70), G135 (= G136), G137 (≠ A140), G138 (≠ A141), A139 (≠ R142), N157 (= N160), R158 (= R161), T159 (= T162), K162 (≠ R165), A200 (= A198), T201 (= T199), P202 (≠ S200), I203 (≠ L201), M205 (≠ L203), L229 (≠ M225), Y231 (= Y227), M255 (= M251), L256 (= L252)
- binding zinc ion: E22 (≠ K20), H23 (= H21)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 95% coverage: 1:272/285 of query aligns to 6:276/287 of 1nvtA
- active site: K75 (= K73), D111 (= D110)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (= G136), A139 (≠ R142), N157 (= N160), R158 (= R161), T159 (= T162), K162 (≠ R165), A200 (= A198), T201 (= T199), P202 (≠ S200), I203 (≠ L201), M205 (≠ L203), L229 (≠ M225), Y231 (= Y227), G252 (= G248), M255 (= M251), L256 (= L252)
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 95% coverage: 1:272/285 of query aligns to 1:271/282 of Q58484
Query Sequence
>CCNA_00003 FitnessBrowser__Caulo:CCNA_00003
MTNAITGAAIVGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFAPAADRFETFVDGLRG
GAVRGLNVTIPFKERALAVADTASDLARMAGAANLLVFNEDGSVHADNTDGPGLLGAIAI
QAPGFDVTAAPVVILGAGGAARGAVAALLLAGAPRIAVVNRTVARAQDLADTFGEKVVAK
GEDALPALLPEAGLIINATSLGLGGGAGPSADLTLTPKTAVVMDMVYKPLRTEFLRRAEA
AGRRTVDGLEMLLRQAIPTFETIYGQAPSPKIDVRVLALKLLGEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory