Comparing CCNA_00021 FitnessBrowser__Caulo:CCNA_00021 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 91% coverage: 51:713/730 of query aligns to 14:706/732 of 8gy3C
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
27% identity, 36% coverage: 210:469/730 of query aligns to 11:296/761 of 1rm6A
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
26% identity, 36% coverage: 210:469/730 of query aligns to 19:304/769 of O33819
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 60% coverage: 208:642/730 of query aligns to 24:485/732 of P77489
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 60% coverage: 208:642/730 of query aligns to 24:485/731 of 5g5gC
Sites not aligning to the query:
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
22% identity, 49% coverage: 201:559/730 of query aligns to 14:402/786 of 1t3qB
Sites not aligning to the query:
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
29% identity, 16% coverage: 598:712/730 of query aligns to 183:303/330 of 3hrdB
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
29% identity, 16% coverage: 598:712/730 of query aligns to 183:303/330 of Q0QLF1
Sites not aligning to the query:
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
31% identity, 17% coverage: 604:725/730 of query aligns to 611:742/748 of 5y6qC
Sites not aligning to the query:
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
24% identity, 38% coverage: 214:487/730 of query aligns to 560:860/1307 of 2e1qA
Sites not aligning to the query:
>CCNA_00021 FitnessBrowser__Caulo:CCNA_00021
MNAPVDPKGLKAIQPSRRDVVVASTMVGGALLVGCSPADLMSAGSKVEVGAFGPFIKIAP
DGVVTVISKHIEFGQGNHAGLAAIVAEELDADWSKVKVEQAPANAKLYANGNMGAQLTGG
SSAISNSWDQLRKAGAGARAMFVQAAANRWNVPVGEITVKDSVLAHTSGKTAIFGELLSD
AAKVNPPTDPKLKDPKAFTLIGSDRVRRKDSQAKSDGTALYTQDVRLPDMLTAMVAHPPR
FGGKVKSFDATEAKKVAGVVEVFEIPTGIAVVAQNTYAARMGREALKVEWDEEKAEKRGS
PAIIQGYRDVLSGKDASVKWEPFDQRGDAAALETAKGADVVELNYEFPYLAHATMEPMNC
VAAVDGNKVKLTFGSQGQTLDQLNVAKVVGCLPGSVEIETLFAGGSFGRRATFQSDYAVE
CVHIAKKVGKGRPVKLVWTREDDMRSGYFRPIVLHALKVKLDKDGLPAAWRHRIVTQSIM
KGAPMPMGKGPDSSAFEGINDSPYLKATPVVDAQVAFPDIGVPVLWWRSVGATHTAFVME
HTIDQLAAKAGKDPVAYRRAIYTKAGAERHLAVLNLALEKAGPKATAGWTRGVAVHESFG
SVVAQIAEVKLENGAPRVGRVVTAIDCGVAISPDQIAAQMEGGTCYGLSAALFGEVTLTD
GQVDQTNFDGYRVLRINEAPSVETHIVPSGNPPSGVGEPGTPVIAPAVANALFALNKAAT
SRLPFVRSEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory