Comparing CCNA_00074 CCNA_00074 multifunctional fatty acid oxidation complex subunit alpha FadJ to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
47% identity, 96% coverage: 9:711/733 of query aligns to 22:729/731 of 4b3iA
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
47% identity, 96% coverage: 9:711/733 of query aligns to 21:728/730 of 8oquA
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8oqnA
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8opvA
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8opuA
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
47% identity, 96% coverage: 9:711/733 of query aligns to 19:726/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
47% identity, 96% coverage: 9:711/733 of query aligns to 19:726/728 of 8oqlA
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
47% identity, 96% coverage: 9:711/733 of query aligns to 14:721/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
47% identity, 96% coverage: 9:711/733 of query aligns to 14:721/723 of 8oqpA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/728 of 8oqrA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
47% identity, 96% coverage: 9:711/733 of query aligns to 26:733/735 of 8oqsB
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
47% identity, 96% coverage: 9:711/733 of query aligns to 18:725/726 of 8oqvA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
47% identity, 96% coverage: 9:711/733 of query aligns to 9:709/711 of 7o4uA
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
38% identity, 98% coverage: 4:722/733 of query aligns to 4:703/707 of 6yswA
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
34% identity, 97% coverage: 13:722/733 of query aligns to 49:762/763 of P40939
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
36% identity, 97% coverage: 12:723/733 of query aligns to 16:707/707 of 1wdmA
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
36% identity, 97% coverage: 12:723/733 of query aligns to 16:715/715 of 1wdlA
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
36% identity, 97% coverage: 12:723/733 of query aligns to 16:715/715 of P28793
>CCNA_00074 CCNA_00074 multifunctional fatty acid oxidation complex subunit alpha FadJ
MENFKIEVDSDGVALVTFDVPGRSMNTLTASVIKEIGEIVERIKSDAEIKGVVITSGKTT
GFCAGADLGELGGGGGMAGGAAGGEAALKAAFDAGFALNKAFRGLETCGKPVAAAINGLA
MGGGLEIALACHYRVVADHPKIQLALPEAKVGLLPGAGGTQRLPRLMGVMAAAPYLLEGK
SMKPAEALANKVVHEVVPVDQVVEAAKTWVKTKGDPVAPWDKKDFKLPGGGPYTPTGGQV
FIMGNAMLRKQTYGNYPAQLNILKAVYEGTQVPFDAAIRIETRYFLKTMMSPQAKGMIRT
LFLSLQELGKGSGRPADVPPSEAKKVAVLGAGMMGAGIAYVQAMAGIETVLIDQSQEAAE
KGKGYAENLLKKAVSRGKMTQDKADAVLALITPTTDYAHVKGSDLVIEAVFESREIKADV
TQKAEAQLAEDAIFGSNTSTLPITGLAKASVRPKNFIGIHFFSPVDKMGLVEIIMGEETS
DEALAKSIDYVLKIKKTPIVVNDSRGFYTSRCFGTFVQEGLEMLADGIAPAIIDNVGRAT
GMPRGPLEMNDDVALDLGYKVTQQTKKDLGDKFEDRPFAPIIEKMVVELQRFGRKNGKGF
YDYPETGPKTLWKGLSELAPVTIAEADQALIQEIRTRLLYRQAVEAARCFEEGVITDPRE
ADVGAILGWGFAPWTGGPISLIDGVGAKAFVETCDQLAQKYGKRFAPPALLREMAEKGET
FYGRFGAKAKAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory