SitesBLAST
Comparing CCNA_00074 FitnessBrowser__Caulo:CCNA_00074 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
47% identity, 96% coverage: 9:711/733 of query aligns to 22:729/731 of 4b3iA
- active site: G79 (≠ A66), E100 (≠ F96), R104 (≠ K100), G127 (= G123), E130 (= E126), P151 (= P147), E152 (= E148), G160 (= G156), S452 (= S439), H473 (= H460), E485 (= E472), S523 (= S510)
- binding adenosine-5'-diphosphate: Q640 (= Q628), P641 (≠ A629), P642 (≠ L630), L643 (≠ I631), Q644 (= Q632)
- binding coenzyme a: T38 (≠ M25), V40 (≠ T27), A77 (= A64), G79 (≠ A66), D80 (= D67), V81 (≠ L68), E152 (= E148), F315 (= F302), Q319 (= Q306)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G65), F169 (≠ M167), N173 (≠ A171), S177 (≠ P174), I193 (≠ N190), F313 (= F302)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ L28), N40 (≠ T29), E41 (≠ A30), T81 (≠ E70), D92 (≠ A81), V93 (≠ A82)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ L28), G77 (≠ A66), D78 (= D67), M82 (≠ L71), V93 (≠ A82)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ K150), R184 (≠ S181), A311 (≠ T300), F312 (≠ L301), I673 (≠ V663)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
47% identity, 96% coverage: 9:711/733 of query aligns to 21:728/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ L28), N41 (≠ T29), E42 (≠ A30), G77 (= G65), G78 (≠ A66), D79 (= D67), V80 (≠ L68), D90 (≠ A78), V94 (≠ A82), L124 (≠ M121), G125 (= G122), P150 (= P147), E151 (= E148)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ A30), G76 (= G65), G77 (≠ A66), D78 (= D67), V79 (≠ L68), M82 (≠ L71), D89 (≠ A78), V93 (≠ A82), T96 (≠ A94), T96 (≠ A94), P149 (= P147), E150 (= E148)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ L28), M82 (≠ L71), E150 (= E148), Q172 (≠ M170), F175 (vs. gap), V176 (≠ A173), Q181 (≠ E178), T241 (≠ G231), F254 (≠ G244), N257 (≠ M247), Q261 (= Q251), L262 (≠ T252), P266 (vs. gap), P268 (= P257), Q282 (= Q271), V283 (= V272), G302 (≠ S291), Q303 (≠ P292), V304 (≠ Q293), S521 (= S510), G525 (= G514)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8opvA
- binding resveratrol: M39 (≠ L28), A75 (= A64), G76 (= G65), M82 (≠ L71), E128 (= E126), P149 (= P147), E150 (= E148), T152 (≠ K150), L153 (≠ V151), R184 (≠ S181), F296 (= F285)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/729 of 8opuA
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
47% identity, 96% coverage: 9:711/733 of query aligns to 19:726/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
47% identity, 96% coverage: 9:711/733 of query aligns to 19:726/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ T27), N39 (≠ T29), G75 (= G65), D77 (= D67), M81 (≠ L71), V92 (≠ A82), T95 (≠ A94), P148 (= P147), E149 (= E148), L152 (≠ V151), Q180 (≠ E178), Q260 (= Q251), K362 (≠ I352), D363 (= D353), V364 (≠ Q354), V430 (= V420), D476 (= D466), K477 (= K467), M478 (= M468), P479 (≠ G469), K506 (= K496)
- binding formamide: V78 (≠ L68), K79 (≠ G69)
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
47% identity, 96% coverage: 9:711/733 of query aligns to 14:721/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
47% identity, 96% coverage: 9:711/733 of query aligns to 14:721/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ R23), S29 (= S24), A63 (≠ G57), K64 (= K58), K64 (= K58), K65 (≠ T59), P143 (= P147), E144 (= E148), L147 (≠ V151), F307 (= F302), M473 (= M468), P548 (= P543), S599 (≠ F592), L602 (≠ K595), K603 (≠ N596), S661 (≠ D657), T662 (≠ P658), G674 (= G670), A698 (≠ K688), R705 (≠ D695)
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
47% identity, 96% coverage: 9:711/733 of query aligns to 20:727/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G65), G77 (≠ A66), T81 (≠ E70), M82 (≠ L71), M82 (≠ L71), A85 (≠ G74), D89 (≠ A78), T96 (≠ A94), L123 (≠ M121), G124 (= G122), P149 (= P147), E150 (= E148), S366 (= S355), L367 (≠ Q356), E368 (= E357), A420 (= A409), V421 (= V410), F422 (= F411)
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
47% identity, 96% coverage: 9:711/733 of query aligns to 26:733/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (≠ L28), I50 (= I33), G82 (= G65), G83 (≠ A66), D84 (= D67), T87 (≠ E70), T87 (≠ E70), M88 (≠ L71), M88 (≠ L71), A91 (≠ G74), D95 (≠ A78), D98 (≠ A81), V99 (≠ A82), T102 (≠ A94), T102 (≠ A94), E134 (= E126), E156 (= E148), L159 (≠ V151), F302 (= F285), F302 (= F285), F319 (= F302), S456 (= S439), T457 (= T440), M485 (= M468), P486 (≠ G469), G523 (= G506), S527 (= S510), N535 (≠ Q518), P560 (= P543), M575 (≠ G558), I578 (≠ V561), I578 (≠ V561), I682 (= I666), M683 (≠ L667), G686 (= G670)
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
47% identity, 96% coverage: 9:711/733 of query aligns to 18:725/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ A30), G74 (= G65), M80 (≠ L71), V91 (≠ A82), T94 (≠ A94), T94 (≠ A94), E148 (= E148), L151 (≠ V151), R182 (≠ S181), S448 (= S439), S519 (= S510), R520 (= R511), L562 (≠ V553), L566 (= L557), I570 (≠ V561)
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
47% identity, 96% coverage: 9:711/733 of query aligns to 9:709/711 of 7o4uA
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
38% identity, 98% coverage: 4:722/733 of query aligns to 4:703/707 of 6yswA
- active site: A66 (= A66), I71 (≠ A78), A84 (≠ F92), Q88 (≠ F96), G112 (= G123), E115 (= E126), P136 (= P147), E137 (= E148), G145 (= G156), D264 (= D275), S422 (= S439), H443 (= H460), E455 (= E472), N493 (≠ S510)
- binding coenzyme a: E23 (≠ R23), M25 (= M25), A66 (= A66), D67 (= D67), I68 (≠ L68), P136 (= P147), E137 (= E148), L140 (≠ V151), T290 (≠ Q306), K293 (≠ G309)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
34% identity, 97% coverage: 13:722/733 of query aligns to 49:762/763 of P40939
- V282 (= V240) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L263) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ F302) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E472) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
36% identity, 97% coverage: 12:723/733 of query aligns to 16:707/707 of 1wdmA
- active site: A69 (= A66), N89 (≠ G95), N93 (= N99), G117 (= G123), E120 (= E126), P139 (= P147), E140 (= E148), P147 (= P155), G148 (= G156), S430 (= S439), H451 (= H460), E463 (= E472), N501 (≠ S510)
- binding acetyl coenzyme *a: K142 (= K150), D297 (≠ L305), M459 (= M468), N501 (≠ S510), P534 (= P543), Y652 (≠ L667), L658 (≠ P673)
- binding nicotinamide-adenine-dinucleotide: G321 (= G330), A322 (= A331), I324 (≠ M333), M325 (= M334), D344 (= D353), V401 (= V410), E403 (= E412), N428 (= N437), S430 (= S439), N454 (≠ S463)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
36% identity, 97% coverage: 12:723/733 of query aligns to 16:715/715 of 1wdlA
- active site: A69 (= A66), N89 (≠ G95), N93 (= N99), G117 (= G123), E120 (= E126), P139 (= P147), E140 (= E148), P147 (= P155), G148 (= G156), S430 (= S439), H451 (= H460), E463 (= E472), N501 (≠ S510)
- binding nicotinamide-adenine-dinucleotide: A322 (= A331), I324 (≠ M333), M325 (= M334), D344 (= D353), I345 (≠ Q354), A400 (= A409), V401 (= V410), E403 (= E412), N428 (= N437), T429 (= T438), S430 (= S439)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
36% identity, 97% coverage: 12:723/733 of query aligns to 16:715/715 of P28793
Query Sequence
>CCNA_00074 FitnessBrowser__Caulo:CCNA_00074
MENFKIEVDSDGVALVTFDVPGRSMNTLTASVIKEIGEIVERIKSDAEIKGVVITSGKTT
GFCAGADLGELGGGGGMAGGAAGGEAALKAAFDAGFALNKAFRGLETCGKPVAAAINGLA
MGGGLEIALACHYRVVADHPKIQLALPEAKVGLLPGAGGTQRLPRLMGVMAAAPYLLEGK
SMKPAEALANKVVHEVVPVDQVVEAAKTWVKTKGDPVAPWDKKDFKLPGGGPYTPTGGQV
FIMGNAMLRKQTYGNYPAQLNILKAVYEGTQVPFDAAIRIETRYFLKTMMSPQAKGMIRT
LFLSLQELGKGSGRPADVPPSEAKKVAVLGAGMMGAGIAYVQAMAGIETVLIDQSQEAAE
KGKGYAENLLKKAVSRGKMTQDKADAVLALITPTTDYAHVKGSDLVIEAVFESREIKADV
TQKAEAQLAEDAIFGSNTSTLPITGLAKASVRPKNFIGIHFFSPVDKMGLVEIIMGEETS
DEALAKSIDYVLKIKKTPIVVNDSRGFYTSRCFGTFVQEGLEMLADGIAPAIIDNVGRAT
GMPRGPLEMNDDVALDLGYKVTQQTKKDLGDKFEDRPFAPIIEKMVVELQRFGRKNGKGF
YDYPETGPKTLWKGLSELAPVTIAEADQALIQEIRTRLLYRQAVEAARCFEEGVITDPRE
ADVGAILGWGFAPWTGGPISLIDGVGAKAFVETCDQLAQKYGKRFAPPALLREMAEKGET
FYGRFGAKAKAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory