SitesBLAST
Comparing CCNA_00092 FitnessBrowser__Caulo:CCNA_00092 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
41% identity, 85% coverage: 4:256/296 of query aligns to 3:247/249 of 4bmsF
- active site: S137 (= S141), H147 (≠ P151), Y150 (= Y154), K154 (= K158), Q195 (≠ P199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ C16), S16 (= S17), I18 (= I19), R38 (≠ E42), R39 (≠ K43), A59 (≠ C60), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (≠ L112), S137 (= S141), Y150 (= Y154), K154 (= K158), G181 (= G185), I183 (= I187), T185 (= T189), I187 (= I191)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
41% identity, 85% coverage: 4:256/296 of query aligns to 3:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S141), H147 (≠ P151), Y150 (= Y154), L188 (≠ F192), L246 (≠ I255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ C16), S16 (= S17), G17 (= G18), I18 (= I19), R38 (≠ E42), R39 (≠ K43), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (≠ L112), T135 (= T139), S137 (= S141), Y150 (= Y154), K154 (= K158), P180 (= P184), G181 (= G185), A182 (≠ L186), I183 (= I187), T185 (= T189), S187 (≠ I191)
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
34% identity, 87% coverage: 4:261/296 of query aligns to 2:262/267 of F1SWA0
- S142 (= S141) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ A143) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y154) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K158) mutation to A: Abolishes all oxidoreductase activity.
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 86% coverage: 1:256/296 of query aligns to 1:253/255 of 5itvA
- active site: G18 (= G18), S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (= S17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ L39), T61 (≠ C60), I63 (≠ V62), N89 (= N88), G91 (= G90), T139 (= T139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), I186 (≠ L186), I187 (= I187)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 85% coverage: 4:255/296 of query aligns to 4:242/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ L113), S139 (= S141), Q149 (≠ P151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (≠ P95), K98 (≠ E100), S139 (= S141), N146 (≠ G148), V147 (≠ F149), Q149 (≠ P151), Y152 (= Y154), F184 (≠ L186), M189 (≠ I191), K200 (≠ Q205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ S17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ L39), V59 (≠ C60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (≠ H91), T137 (= T139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (≠ L186), T185 (≠ I187), T187 (= T189), M189 (≠ I191)
Q9C826 Xanthoxin dehydrogenase; Protein ABSCISIC ACID DEFICIENT 2; Protein GLUCOSE INSENSITIVE 1; Protein IMPAIRED SUCROSE INDUCTION 4; Protein SALOBRENO 3; Protein SALT RESISTANT 1; Protein SUGAR INSENSITIVE 4; Short-chain alcohol dehydrogenase ABA2; Short-chain dehydrogenase reductase 1; AtSDR1; Xanthoxin oxidase; EC 1.1.1.288 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
37% identity, 87% coverage: 4:261/296 of query aligns to 17:280/285 of Q9C826
- G28 (= G15) mutation to R: In aba2-12/sre1-2; reduced absicic acid synthesis.
- A45 (= A32) mutation to V: In aba2-4/sis4-2; reduced absicic acid synthesis.
- R145 (≠ P126) mutation to C: In gin1-2; reduced absicic acid synthesis.
- G162 (≠ A143) mutation to R: In aba2-3/sis4-1; reduced absicic acid synthesis.
- S176 (≠ A157) mutation to F: In aba2-13/san3-1; reduced absicic acid synthesis.
- A236 (≠ P215) mutation to V: In isi4; reduced absicic acid synthesis.
- S264 (≠ T245) mutation to N: In aba2-1; reduced absicic acid synthesis.
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
36% identity, 86% coverage: 1:256/296 of query aligns to 1:259/261 of 6zzsD
- active site: G18 (= G18), S143 (= S141), Y156 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (= S17), I19 (= I19), D38 (= D38), M39 (≠ L39), D64 (= D61), V65 (= V62), N91 (= N88), A92 (= A89), G93 (= G90), M141 (≠ T139), A142 (= A140), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), V189 (≠ I187), T191 (= T189), L193 (≠ I191)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ G92), S143 (= S141), N145 (≠ A143), K153 (≠ P151), Y156 (= Y154), Q197 (≠ E201)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
36% identity, 85% coverage: 5:256/296 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G18), S142 (= S141), Y155 (= Y154)
- binding acetoacetic acid: Q94 (≠ G92), S142 (= S141), K152 (≠ P151), Y155 (= Y154), Q196 (≠ E201)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), S16 (= S17), G17 (= G18), I18 (= I19), D37 (= D38), M38 (≠ L39), D63 (= D61), V64 (= V62), N90 (= N88), A91 (= A89), G92 (= G90), M140 (≠ T139), A141 (= A140), S142 (= S141), Y155 (= Y154), K159 (= K158), Y187 (≠ L186), V188 (≠ I187), T190 (= T189)
6zyzA Structure of the borneol dehydrogenases of salvia rosmarinus with NAD+ (see paper)
35% identity, 86% coverage: 4:257/296 of query aligns to 2:248/259 of 6zyzA
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (= S17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), Q38 (= Q40), C58 (= C60), D59 (= D61), V60 (= V62), N86 (= N88), A87 (= A89), V90 (≠ G92), I110 (≠ L112), T137 (= T139), Y152 (= Y154), K156 (= K158), V185 (≠ A194)
- binding (2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2R)-2-hydroxypropyl]oxy}methyl)propoxy]propan-2-ol: P93 (= P95), N94 (≠ A96), S95 (= S97), D98 (≠ E100)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
38% identity, 85% coverage: 5:256/296 of query aligns to 3:249/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (= D38), L37 (= L39), C61 (= C60), D62 (= D61), V63 (= V62), N89 (= N88), A90 (= A89), T140 (= T139), S142 (= S141), Y155 (= Y154), K159 (= K158), A186 (≠ G185), V187 (≠ L186)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases (see paper)
36% identity, 84% coverage: 8:256/296 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G18), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ G148), R152 (≠ P151), Y155 (= Y154), W195 (≠ A194), R196 (≠ S195)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), S12 (= S17), G13 (= G18), N14 (≠ I19), D33 (= D38), L34 (= L39), A59 (≠ C60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I140 (≠ T139), P185 (= P184), G186 (= G185), M187 (≠ L186), I188 (= I187), T190 (= T189), P191 (≠ S190), M192 (≠ I191), T193 (≠ F192)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 87% coverage: 1:258/296 of query aligns to 1:241/260 of P9WGT1
- I6 (≠ N6) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ SGI 17:19) binding
- D38 (= D38) binding
- V47 (≠ L47) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 61:62) binding
- T69 (≠ A69) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N88) binding
- S140 (= S141) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y154) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K158) binding
- 183:191 (vs. 184:195, 33% identical) binding
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
36% identity, 86% coverage: 5:259/296 of query aligns to 3:245/253 of 2hsdA
- active site: G16 (= G18), S138 (= S141), Y151 (= Y154), K155 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (≠ S17), G16 (= G18), L17 (≠ I19), D36 (= D38), V37 (≠ L39), L58 (≠ C60), V60 (= V62), N86 (= N88), A87 (= A89), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185), T184 (≠ I187)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
36% identity, 86% coverage: 5:259/296 of query aligns to 3:245/253 of 1hdcA
- active site: G16 (= G18), S138 (= S141), Y151 (= Y154), K155 (= K158)
- binding carbenoxolone: S90 (≠ G93), T91 (= T94), G92 (≠ P95), L147 (≠ G150), Y151 (= Y154), M183 (≠ L186), M188 (≠ I191), T189 (≠ F192), T192 (≠ M196)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
34% identity, 86% coverage: 3:258/296 of query aligns to 2:240/244 of 1nfqA
- active site: G17 (= G18), S139 (= S141), Y152 (= Y154), K156 (= K158)
- binding Androsterone: L91 (≠ G92), E141 (≠ A143), C149 (≠ P151), Y152 (= Y154), V193 (≠ L198), I197 (≠ V202), F198 (≠ A203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ S17), G17 (= G18), M18 (≠ I19), D37 (= D38), L39 (≠ Q40), L59 (≠ C60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), I137 (≠ T139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), V185 (≠ I187), T187 (= T189), P188 (≠ S190), M189 (≠ I191), T190 (≠ S195)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
34% identity, 86% coverage: 3:258/296 of query aligns to 2:240/244 of 1nffA
- active site: G17 (= G18), S139 (= S141), Y152 (= Y154), K156 (= K158)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), R16 (≠ S17), G17 (= G18), M18 (≠ I19), D37 (= D38), I38 (≠ L39), L39 (≠ Q40), L59 (≠ C60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (≠ H91), I137 (≠ T139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), V185 (≠ I187), T187 (= T189), P188 (≠ S190), M189 (≠ I191), T190 (≠ S195)
Q94KL8 Secoisolariciresinol dehydrogenase; EC 1.1.1.331 from Podophyllum peltatum (American mandrake) (see 2 papers)
36% identity, 86% coverage: 3:256/296 of query aligns to 12:263/278 of Q94KL8
- GGAGGI 23:28 (≠ GGCSGI 14:19) binding
- D47 (= D38) binding
- V73 (= V62) binding
- N99 (= N88) binding
- S104 (≠ G92) binding
- S153 (= S141) mutation to A: Strongly reduces enzyme activity.
- S164 (≠ P151) binding
- Y167 (= Y154) active site, Proton donor/acceptor; mutation to A: Abolishes enzyme activity.
- K171 (= K158) binding ; mutation to A: Abolishes enzyme activity.
2bgmA X-ray structure of ternary-secoisolariciresinol dehydrogenase (see paper)
36% identity, 86% coverage: 3:256/296 of query aligns to 2:253/267 of 2bgmA
- active site: S143 (= S141), Y157 (= Y154), K161 (= K158)
- binding matairesinol: L93 (≠ H91), S94 (≠ G92), I144 (= I142), G152 (= G150), V153 (vs. gap), S154 (≠ P151), Y157 (= Y154), Y188 (≠ G185), I189 (≠ L186)
- binding nicotinamide-adenine-dinucleotide (acidic form): G13 (= G14), G16 (≠ S17), I18 (= I19), D37 (= D38), I38 (≠ L39), C61 (= C60), D62 (= D61), V63 (= V62), N89 (= N88), V90 (≠ A89), G91 (= G90), T141 (= T139), S143 (= S141), Y157 (= Y154), K161 (= K158), V190 (≠ I187)
2bglA X-ray structure of binary-secoisolariciresinol dehydrogenase (see paper)
36% identity, 86% coverage: 3:256/296 of query aligns to 2:253/267 of 2bglA
- active site: S143 (= S141), Y157 (= Y154), K161 (= K158)
- binding nicotinamide-adenine-dinucleotide (acidic form): G16 (≠ S17), G17 (= G18), I18 (= I19), D37 (= D38), I38 (≠ L39), V63 (= V62), N89 (= N88), G91 (= G90), T141 (= T139), A142 (= A140), S143 (= S141), Y157 (= Y154), K161 (= K158), V190 (≠ I187)
6zt2A 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 3-chloro-2,6-difluorophenol
36% identity, 79% coverage: 24:258/296 of query aligns to 22:248/252 of 6zt2A
- binding beta-D-glucopyranose: W184 (≠ A188), T185 (= T189), P186 (≠ S190), E189 (≠ R200)
- binding nicotinamide-adenine-dinucleotide: D36 (= D38), K37 (≠ L39), D58 (= D61), V59 (= V62), N85 (= N88), L109 (= L112), S137 (= S141), Y150 (= Y154), K154 (= K158), P180 (= P184), G181 (= G185), N182 (≠ L186), I183 (= I187), T185 (= T189), L187 (≠ I191)
- binding 3-chloranyl-2,6-bis(fluoranyl)phenol: H89 (≠ G92), S137 (= S141), Y150 (= Y154), N182 (≠ L186), W188 (≠ F192)
Sites not aligning to the query:
Query Sequence
>CCNA_00092 FitnessBrowser__Caulo:CCNA_00092
MVGRLNGKVAVITGGCSGIGLGTVELFVAEGACVVAADLQDEKGRMLEQRFPDQVRFARC
DVTADDDLAKTMALAESSFGGLDILFNNAGHGGTPASVPELTAEAWDKTFALLVRGPAMG
MTHALPLMQKRGGGSIINTASIAGLQAGFGPLAYSSAKAAVIHMSRCAAAELSPQKIRVN
AICPGLIATSIFGASMGLPREVADQMAAQIASIGPKIQPIPKSGLPEDIAAAALYLASDD
SRFVTGTHIVVDGGITVGPRSAWDINTPSPILAAMGITPEQAEQMRAQLLAAGGTG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory