Comparing CCNA_00096 FitnessBrowser__Caulo:CCNA_00096 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
45% identity, 93% coverage: 8:279/292 of query aligns to 6:298/321 of P37595
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
36% identity, 97% coverage: 8:289/292 of query aligns to 5:305/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
36% identity, 97% coverage: 8:289/292 of query aligns to 6:297/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
36% identity, 97% coverage: 8:289/292 of query aligns to 6:295/298 of 4pvrA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
38% identity, 77% coverage: 57:281/292 of query aligns to 56:278/298 of 4o48A
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
36% identity, 97% coverage: 8:289/292 of query aligns to 6:292/295 of 4o0hA
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
53% identity, 40% coverage: 162:279/292 of query aligns to 1:120/135 of 2zalB
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
53% identity, 40% coverage: 162:279/292 of query aligns to 1:120/135 of 8c23DDD
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
34% identity, 83% coverage: 40:280/292 of query aligns to 25:279/295 of 1p4vA
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
34% identity, 83% coverage: 40:280/292 of query aligns to 70:324/340 of Q47898
Sites not aligning to the query:
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
34% identity, 83% coverage: 40:280/292 of query aligns to 23:277/293 of 4r4yA
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
32% identity, 91% coverage: 10:274/292 of query aligns to 6:242/313 of 2a8jB
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
31% identity, 91% coverage: 10:274/292 of query aligns to 46:335/420 of Q9H6P5
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
44% identity, 47% coverage: 8:144/292 of query aligns to 5:145/156 of 8c0iAAA
Sites not aligning to the query:
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
44% identity, 47% coverage: 8:144/292 of query aligns to 5:145/158 of 1jn9A
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
49% identity, 42% coverage: 162:285/292 of query aligns to 1:123/133 of 2gezB
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
45% identity, 42% coverage: 162:285/292 of query aligns to 1:123/131 of 4pu6B
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
34% identity, 61% coverage: 24:202/292 of query aligns to 31:246/346 of P20933
Sites not aligning to the query:
P30919 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Rattus norvegicus (Rat) (see paper)
36% identity, 61% coverage: 24:200/292 of query aligns to 31:243/345 of P30919
Sites not aligning to the query:
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
38% identity, 45% coverage: 6:137/292 of query aligns to 3:138/166 of 2gezC
>CCNA_00096 FitnessBrowser__Caulo:CCNA_00096
MSNKRFSLALHGGAGAKRGHDYGVEIAHMRGLVEAARDRLAAGAGALDVAVETVVGLEAS
GLYIAGKGASPNADGEYELDASLMDGATLRAGSVAALQGFKSPILAARAVMEHTPHVMLA
GQGAIAFAREQGLETVEDPDAWFTRAGAFEDNHPPDALPTGTVGCVVRDGEGRLAAATST
AGVFGKRPGRVGDSPIIGAGAWADGHAAVSCTGQGEYFIRAAVAAQIAHRVRFGGEALDA
AAQAAIDSVAALGGHGGLIAVDRDGNIAMPFVSSGLKRAALMPDGTIVSAAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory