SitesBLAST
Comparing CCNA_00117 FitnessBrowser__Caulo:CCNA_00117 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
46% identity, 100% coverage: 2:606/606 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E478), K485 (= K482), E488 (= E485), H504 (= H501), K603 (= K601)
- binding fructose -6-phosphate: G301 (= G298), T302 (= T299), S303 (= S300), S347 (= S344), Q348 (= Q345), S349 (= S346), T352 (= T349), S401 (= S397), K485 (= K482), E488 (= E485)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
46% identity, 100% coverage: 2:606/606 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E478), K485 (= K482), E488 (= E485), H504 (= H501), K603 (= K601)
- binding glucose-6-phosphate: T302 (= T299), S303 (= S300), S347 (= S344), Q348 (= Q345), S349 (= S346), T352 (= T349), S401 (= S397), K485 (= K482), E488 (= E485)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
46% identity, 100% coverage: 2:606/606 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E478), K485 (= K482), E488 (= E485), H504 (= H501), K603 (= K601)
- binding glucose-6-phosphate: T302 (= T299), S347 (= S344), Q348 (= Q345), S349 (= S346), T352 (= T349), V399 (= V395), S401 (= S397), E488 (= E485)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
38% identity, 100% coverage: 2:606/606 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E533 (= E478), K537 (= K482), E540 (= E485), H556 (= H501), K655 (= K601)
- binding glucose-6-phosphate: C353 (= C297), T355 (= T299), S356 (= S300), S400 (= S344), Q401 (= Q345), S402 (= S346), T405 (= T349), S453 (= S397), K537 (= K482), E540 (= E485)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), H107 (= H86), G123 (= G99), D147 (= D123)
- binding magnesium ion: S434 (≠ A378), R435 (= R379), T437 (≠ V381)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ S240), R322 (≠ Y270), G334 (= G282), G424 (≠ V368), T426 (≠ V370), S434 (≠ A378), T437 (≠ V381), C439 (≠ V383), G440 (≠ V384), V441 (≠ W385), H442 (≠ P386)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
38% identity, 100% coverage: 2:606/606 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E536 (= E478), K540 (= K482), E543 (= E485), H559 (= H501), K658 (= K601)
- binding glucose-6-phosphate: T358 (= T299), S359 (= S300), S403 (= S344), Q404 (= Q345), S405 (= S346), T408 (= T349), S456 (= S397), K540 (= K482), E543 (= E485)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), G123 (= G99), D147 (= D123)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
38% identity, 99% coverage: 2:599/606 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E532 (= E478), K536 (= K482), E539 (= E485), H555 (= H501)
- binding glucose-6-phosphate: G353 (= G298), T354 (= T299), S355 (= S300), S399 (= S344), Q400 (= Q345), S401 (= S346), T404 (= T349), S452 (= S397), E539 (= E485)
- binding magnesium ion: S433 (≠ A378), R434 (= R379), T436 (≠ V381)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ S240), R321 (≠ Y270), G333 (= G282), G423 (≠ V368), T425 (≠ V370), S433 (≠ A378), T436 (≠ V381), C438 (≠ V383), G439 (≠ V384), V440 (≠ W385), H441 (≠ P386)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
36% identity, 100% coverage: 1:606/606 of query aligns to 1:699/699 of Q06210
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 100% coverage: 1:606/606 of query aligns to 1:717/717 of P14742
- M1 (= M1) modified: Initiator methionine, Removed
- C2 (= C2) active site, For GATase activity
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
46% identity, 60% coverage: 244:606/606 of query aligns to 3:367/367 of 1mosA
- active site: E240 (= E478), K244 (= K482), E247 (= E485), H263 (= H501), K362 (= K601)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T299), S62 (= S300), S106 (= S344), Q107 (= Q345), S108 (= S346), T111 (= T349), K244 (= K482), E247 (= E485)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
46% identity, 60% coverage: 244:606/606 of query aligns to 2:366/366 of 1morA
- active site: E239 (= E478), K243 (= K482), E246 (= E485), H262 (= H501), K361 (= K601)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T299), S105 (= S344), Q106 (= Q345), S107 (= S346), T110 (= T349), V157 (= V395), A360 (= A600), K361 (= K601)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
46% identity, 60% coverage: 244:606/606 of query aligns to 2:366/366 of 1moqA
- active site: E239 (= E478), K243 (= K482), E246 (= E485), H262 (= H501), K361 (= K601)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T299), S61 (= S300), S105 (= S344), Q106 (= Q345), S107 (= S346), T110 (= T349), V157 (= V395), A360 (= A600), K361 (= K601)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
44% identity, 58% coverage: 244:597/606 of query aligns to 2:357/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
42% identity, 60% coverage: 245:606/606 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E478), K242 (= K482), E245 (= E485), H261 (= H501), K360 (= K601)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T299), S61 (= S300), S105 (= S344), Q106 (= Q345), S107 (= S346), T110 (= T349), V156 (= V395), A157 (= A396), K242 (= K482), E245 (= E485)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
42% identity, 60% coverage: 245:606/606 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E478), K242 (= K482), E245 (= E485), H261 (= H501), K360 (= K601)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T299), S61 (= S300), S105 (= S344), Q106 (= Q345), S107 (= S346), T110 (= T349), V156 (= V395), A359 (= A600), K360 (= K601)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
40% identity, 58% coverage: 245:594/606 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E478), K241 (= K482), E244 (= E485), H260 (= H501)
- binding fructose -6-phosphate: T59 (= T299), S60 (= S300), S104 (= S344), Q105 (= Q345), S106 (= S346), T109 (= T349), A156 (= A396), S157 (= S397), K241 (= K482), E244 (= E485)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 57% coverage: 248:594/606 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E478), K240 (= K482), E243 (= E485), H259 (= H501)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C297), T57 (= T299), S58 (= S300), S102 (= S344), Q103 (= Q345), S104 (= S346), T107 (= T349), E243 (= E485)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ Y270), G36 (= G282), G126 (≠ V368), V128 (= V370), S136 (≠ A378), T139 (≠ V381), C141 (≠ V383), G142 (≠ V384), V143 (≠ W385), H144 (≠ P386)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
49% identity, 38% coverage: 2:231/606 of query aligns to 1:231/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
49% identity, 38% coverage: 2:231/606 of query aligns to 1:231/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamic acid: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 57% coverage: 248:594/606 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E478), K240 (= K482), E243 (= E485)
- binding fructose -6-phosphate: C55 (= C297), T57 (= T299), S102 (= S344), Q103 (= Q345), S104 (= S346), T107 (= T349), A154 (= A396), S155 (= S397), K240 (= K482)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ Y270), G36 (= G282), G126 (≠ V368), V128 (= V370), S136 (≠ A378), T139 (≠ V381), C141 (≠ V383), G142 (≠ V384), V143 (≠ W385), H144 (≠ P386)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 57% coverage: 248:594/606 of query aligns to 2:331/331 of 2puwB
Query Sequence
>CCNA_00117 FitnessBrowser__Caulo:CCNA_00117
MCGIIGIVGKEPVADRLIESLKRLEYRGYDSAGVAGVVGGKVERRRAQGKIKALEAVLAD
EPLTATTGIGHTRWATHGAPNVRNAHPHTAGRVTLVHNGIIENFAELKAELAGMGRTFES
DTDTEVIAQLIDVALAKGLAPLDAFKATLDRLTGAYALAVLIQGEADLLLGARRGSPLVV
GEGQGEMFLGSDALAVGPFTNRVIYLEEGDYVALDHDSRRIFDASGARVERPVRVVPTSS
VMLEKGNYRHFMEKEIHDQPEGCQRTIAAYVDTLTSKAAVPGDIDFATLDRIQIVACGTS
YIAGVIGKYLIEQLADLPVDVEIASEFRYRTPALRPGSLVVAMSQSGETADTLAALRYCK
AKGMKSAVVVNAQESTMAREVDVVWPIHCGPEIGVASTKAFTAQVSVMIALAIAAAKARG
TIDAAEEQRLVKVLLEAPRLIAEAIGLEDAIKEIAADVAKARDVLYLGRGPMSALALEGA
LKLKEISYIHAEGYAAGELKHGPIALVDDQTPIVILAPYDSYFEKSASNMSEVMARGGQV
IFITDTEGVKHAPAGAKVVVTAPASDPLVSTLVMSAPIQLLAYHVAVVKGADVDQPRNLA
KSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory