Comparing CCNA_00212 FitnessBrowser__Caulo:CCNA_00212 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
51% identity, 97% coverage: 3:286/292 of query aligns to 7:291/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
51% identity, 97% coverage: 3:286/292 of query aligns to 3:287/297 of 5h8jB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
51% identity, 97% coverage: 3:286/292 of query aligns to 4:288/298 of 5h8lB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
33% identity, 92% coverage: 16:283/292 of query aligns to 15:261/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
33% identity, 92% coverage: 16:283/292 of query aligns to 21:267/269 of 6ypaB
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
32% identity, 90% coverage: 21:283/292 of query aligns to 18:259/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
32% identity, 90% coverage: 21:283/292 of query aligns to 18:259/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
32% identity, 90% coverage: 21:283/292 of query aligns to 19:260/262 of Q9UYV8
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
28% identity, 89% coverage: 23:283/292 of query aligns to 98:365/384 of Q9UBR1
Sites not aligning to the query:
Q964D8 Beta-ureidopropionase; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Dictyostelium discoideum (Social amoeba)
26% identity, 96% coverage: 3:283/292 of query aligns to 73:368/391 of Q964D8
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
27% identity, 96% coverage: 4:283/292 of query aligns to 3:269/276 of Q9NQR4
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
27% identity, 89% coverage: 28:288/292 of query aligns to 31:303/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
27% identity, 89% coverage: 28:288/292 of query aligns to 30:302/303 of 8hpcC
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
27% identity, 89% coverage: 28:288/292 of query aligns to 30:302/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
27% identity, 89% coverage: 28:288/292 of query aligns to 30:302/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
27% identity, 89% coverage: 28:288/292 of query aligns to 30:302/303 of 1uf5A
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 95% coverage: 3:278/292 of query aligns to 35:302/307 of Q94JV5
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 95% coverage: 7:283/292 of query aligns to 8:306/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
24% identity, 95% coverage: 7:283/292 of query aligns to 5:303/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
24% identity, 95% coverage: 7:283/292 of query aligns to 5:303/304 of 4hg3A
>CCNA_00212 FitnessBrowser__Caulo:CCNA_00212
MARTLSVAAIQTSYGMDLQANIKKTEGFIREAASKGAQVILPSELFQGPYFCVAQEERWF
AQAHPWREHPVVKAIAPLAGELGVVIPISIFEREGPHYFNSLVMADADGSLMGVYRKSHI
PDGPGYMEKYYFRPGDTGFKVWDTRFGRIGVGICWDQWYPECARAMALMGAEALFYPTAI
GSEPHDASLDTALPWRRAMQGHAVSNVIPVIGANRIGFEPWDGYPNGGQTFYGSSFVADH
RGDLVSELGRADEGLVSATFDLDFLTTHRAAWGFFRDRRPELYTALSSGRPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory