SitesBLAST
Comparing CCNA_00264 FitnessBrowser__Caulo:CCNA_00264 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
32% identity, 97% coverage: 2:407/417 of query aligns to 5:421/425 of O59010
- S65 (≠ T61) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A268) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 268:270) binding
- M311 (≠ L303) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S306) binding
- V355 (= V347) binding
- D394 (= D380) binding
- M395 (= M381) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R383) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N387) binding
- D405 (≠ N391) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
32% identity, 97% coverage: 2:405/417 of query aligns to 5:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y7 (≠ R4), F46 (≠ I42), F46 (≠ I42), P75 (≠ D71), L91 (≠ G88), F95 (≠ V92), L130 (= L130), I133 (≠ F133), I159 (≠ L159), Y167 (≠ A167), K196 (= K188), G200 (≠ F192), I207 (≠ L199), F210 (= F202), L250 (≠ G242), I262 (≠ F254), M269 (≠ V261), T334 (= T326), V335 (= V327), G336 (≠ Q328), T340 (≠ F332), L343 (= L335), M399 (≠ A385)
- binding aspartic acid: S277 (= S269), S278 (= S270), T314 (≠ S306), G354 (= G346), A358 (= A350), G359 (≠ S351), D394 (= D380), R397 (= R383), T398 (≠ S384)
- binding sodium ion: Y89 (≠ F86), T92 (≠ A89), S93 (= S90), G306 (= G298), T308 (≠ S300), N310 (= N302), N310 (= N302), M311 (≠ L303), D312 (= D304), S349 (= S341), I350 (≠ K342), T352 (≠ I344), N401 (= N387), V402 (= V388), D405 (≠ N391)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 95% coverage: 9:403/417 of query aligns to 8:409/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
33% identity, 94% coverage: 9:402/417 of query aligns to 7:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
32% identity, 96% coverage: 2:402/417 of query aligns to 2:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ R4), G66 (= G65), V83 (≠ M83), I157 (≠ F160), Y164 (≠ A167), K193 (= K188), T305 (≠ S300), I306 (≠ F301), I347 (≠ K342)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ M13), M199 (= M194), S275 (= S270), T311 (≠ S306), G356 (≠ S351), L384 (= L373), D391 (= D380), R394 (= R383)
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
32% identity, 94% coverage: 9:402/417 of query aligns to 8:408/408 of 6bauA
- binding cysteine: S270 (= S270), M303 (≠ L303), T306 (≠ S306), A345 (= A345), G346 (= G346), V347 (= V347), G351 (≠ S351), D386 (= D380), C389 (≠ R383), T390 (≠ S384), N393 (= N387)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 96% coverage: 9:407/417 of query aligns to 11:418/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K188), G195 (≠ F192), R282 (= R276)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A268), S272 (= S269), S273 (= S270), M307 (≠ L303), T310 (≠ S306), G353 (≠ R349), A354 (= A350), R394 (= R383), T395 (≠ S384)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 96% coverage: 9:407/417 of query aligns to 12:419/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 96% coverage: 9:407/417 of query aligns to 7:410/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A268), S265 (= S270), M299 (≠ L303), T302 (≠ S306), T340 (≠ I344), G342 (= G346), V343 (= V347), G347 (≠ S351), D383 (= D380), R386 (= R383), T387 (≠ S384), N390 (= N387)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Q25), V212 (≠ L217), A216 (≠ G221)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 96% coverage: 9:407/417 of query aligns to 14:421/427 of 5e9sA
- binding aspartic acid: R274 (≠ A268), S275 (= S269), S276 (= S270), T313 (≠ S306), G353 (= G346), V354 (= V347), A357 (= A350), G358 (≠ S351), D394 (= D380), R397 (= R383), T398 (≠ S384)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K188), G198 (≠ F192), Y202 (≠ L196)
- binding sodium ion: Y87 (≠ F86), T90 (≠ A89), S91 (= S90), S276 (= S270), G305 (= G298), A306 (≠ Y299), T307 (≠ S300), N309 (= N302), N309 (= N302), M310 (≠ L303), D311 (= D304), S348 (= S341), I349 (≠ K342), G350 (= G343), T351 (≠ I344), N401 (= N387), V402 (= V388), D405 (≠ N391)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 96% coverage: 9:407/417 of query aligns to 14:421/426 of 6xwnB
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
31% identity, 94% coverage: 9:402/417 of query aligns to 8:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 87% coverage: 44:407/417 of query aligns to 58:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V75), G89 (= G76), G92 (= G79), A95 (≠ T82), V96 (≠ M83), Y99 (≠ F86), M163 (≠ L159), F167 (≠ T163), F293 (= F293), V297 (≠ L297)
- binding aspartic acid: S268 (= S269), S269 (= S270), T306 (≠ S306), G346 (= G346), I347 (≠ V347), A350 (= A350), G351 (≠ S351), D380 (= D380), R383 (= R383), T384 (≠ S384)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 98% coverage: 2:411/417 of query aligns to 4:424/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S269), S281 (= S270), T318 (≠ S306), G363 (≠ S351), M367 (≠ I355), V385 (≠ L373), D388 (= D376), R395 (= R383), T396 (≠ S384)
- binding dodecyl beta-D-glucopyranoside: V16 (≠ I14), V19 (= V17), I20 (≠ L18), W389 (≠ H377)
- binding cholesterol hemisuccinate: R80 (= R77), R84 (≠ K81), I95 (≠ V92), I252 (≠ A241)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 98% coverage: 2:411/417 of query aligns to 3:425/425 of 7xr4A
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
26% identity, 96% coverage: 8:406/417 of query aligns to 24:465/503 of Q10901
- N177 (≠ E150) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 87% coverage: 44:407/417 of query aligns to 50:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V66), S80 (≠ V75), G81 (= G76), G84 (= G79), Y91 (≠ F86), M156 (≠ L159), F160 (≠ T163), F286 (= F293), V290 (≠ L297)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V58), I148 (= I151), S262 (= S270), S263 (≠ E271), A292 (≠ Y299), T293 (≠ S300), M296 (≠ L303), T299 (≠ S306), G329 (= G343), A336 (= A350), G337 (≠ S351), D366 (= D380), R369 (= R383), N373 (= N387)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 94% coverage: 8:398/417 of query aligns to 2:395/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T61), L58 (= L62), L65 (≠ M69), V339 (≠ K342), G340 (= G343), S343 (≠ G346), I344 (≠ V347)
- binding cholesterol: L2 (= L8), W188 (≠ K195), I227 (≠ M231), F250 (= F254), W257 (≠ V261), M379 (≠ G382), S382 (≠ A385)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S270), M300 (≠ L303), T303 (≠ S306), Y306 (= Y309), G348 (≠ S351), L349 (= L352), M352 (≠ I355), I366 (= I369), L369 (≠ V372), V370 (≠ L373), D373 (= D376), D377 (= D380), R380 (= R383), T381 (≠ S384), N384 (= N387)
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
27% identity, 98% coverage: 2:411/417 of query aligns to 39:506/573 of P31596
- K298 (≠ T208) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ L246) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
27% identity, 98% coverage: 2:411/417 of query aligns to 39:506/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>CCNA_00264 FitnessBrowser__Caulo:CCNA_00264
MNKRFAYLIIASMILGVLVGWTCNQFLDPAGAKSAADNLSIITDIFLRLIKMIIAPLVFT
TLVAGVAHMEDAAAVGRIGAKTMTWFIGASAVSLVLGLLMVHLLDPGAGLNMAHVDVAMK
TTATTDAFTLKGFITHLVPTSIFDAMAKNEILQIVVFSLFVGTAVAALDDKAPQILELVE
QAAQIMLKVTGFVMKLAPLAIFAALASTIATQGLGMLATYGKFVLGFYSAMGVLWALLFI
AGLLVLGKRVIPLFGVIRDPVLLAFSTASSEAAYPRILDSLPKVGVRRRIVSFVLPLGYS
FNLDGSMLYCTFATMFIVQAHGVELTVQQQIFMLLLLMVTSKGIAGVPRASLVVIMATLT
YFGLPEAWIALVLGVDHLLDMGRSATNVVGNSVAAAVVAKWEGELDDIPPEGEAAKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory