Comparing CCNA_00277 FitnessBrowser__Caulo:CCNA_00277 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
46% identity, 96% coverage: 14:383/386 of query aligns to 6:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
46% identity, 96% coverage: 14:382/386 of query aligns to 6:375/375 of 4pqaA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
44% identity, 95% coverage: 14:378/386 of query aligns to 10:375/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
44% identity, 95% coverage: 14:378/386 of query aligns to 6:371/377 of P44514
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
44% identity, 93% coverage: 24:383/386 of query aligns to 16:376/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
43% identity, 97% coverage: 8:383/386 of query aligns to 2:377/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
54% identity, 44% coverage: 14:184/386 of query aligns to 8:182/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
55% identity, 44% coverage: 16:184/386 of query aligns to 8:180/265 of 4op4B
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 96% coverage: 12:383/386 of query aligns to 9:383/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 92% coverage: 14:368/386 of query aligns to 6:364/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 78% coverage: 69:369/386 of query aligns to 98:408/426 of 3pfoA
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
25% identity, 83% coverage: 61:381/386 of query aligns to 74:457/458 of 2pokA
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 90% coverage: 14:362/386 of query aligns to 13:378/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 94% coverage: 1:362/386 of query aligns to 1:379/408 of Q03154
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
30% identity, 32% coverage: 70:193/386 of query aligns to 127:252/507 of Q96KN2
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
25% identity, 60% coverage: 31:263/386 of query aligns to 39:264/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
25% identity, 60% coverage: 31:263/386 of query aligns to 64:289/415 of P06621
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 32% coverage: 70:193/386 of query aligns to 96:219/471 of 3dljA
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
30% identity, 69% coverage: 24:288/386 of query aligns to 24:274/366 of Q8P8J5
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
26% identity, 45% coverage: 52:223/386 of query aligns to 103:278/503 of Q8C165
Sites not aligning to the query:
>CCNA_00277 FitnessBrowser__Caulo:CCNA_00277
MTSPAPVSVSIDPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGEIENLY
ARRGTARPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMKSAIAAFVAAV
ANVPDHPGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKI
GRRGSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITT
IDVGNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKISGE
AFLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDE
RVPVEEVRQLAGAYEALIRRYFAAFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory