Comparing CCNA_00310 FitnessBrowser__Caulo:CCNA_00310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2p3nA Thermotoga maritima impase tm1415 (see paper)
32% identity, 87% coverage: 1:225/259 of query aligns to 1:223/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
32% identity, 87% coverage: 1:225/259 of query aligns to 1:223/256 of O33832
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 97% coverage: 2:253/259 of query aligns to 4:257/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
36% identity, 97% coverage: 2:253/259 of query aligns to 2:255/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
36% identity, 97% coverage: 2:253/259 of query aligns to 1:254/255 of 5yhtA
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
29% identity, 78% coverage: 21:223/259 of query aligns to 11:211/238 of 3luzA
Sites not aligning to the query:
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
29% identity, 86% coverage: 4:226/259 of query aligns to 7:241/274 of 2bjiA
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
31% identity, 85% coverage: 4:223/259 of query aligns to 5:232/262 of 2qflA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
29% identity, 86% coverage: 4:226/259 of query aligns to 9:243/277 of P20456
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 85% coverage: 4:223/259 of query aligns to 5:232/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
31% identity, 85% coverage: 4:223/259 of query aligns to 9:236/270 of 6ib8B
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
29% identity, 85% coverage: 4:223/259 of query aligns to 4:229/258 of 3lv0A
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
28% identity, 75% coverage: 31:223/259 of query aligns to 22:207/234 of 3luzB
Sites not aligning to the query:
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
27% identity, 86% coverage: 4:226/259 of query aligns to 5:239/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
27% identity, 86% coverage: 4:226/259 of query aligns to 5:239/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
27% identity, 86% coverage: 4:226/259 of query aligns to 5:239/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
27% identity, 86% coverage: 4:226/259 of query aligns to 5:239/272 of 1awbA
6zk0AAA human impase with ebselen (see paper)
27% identity, 86% coverage: 4:226/259 of query aligns to 6:240/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
27% identity, 86% coverage: 4:226/259 of query aligns to 7:241/274 of 4as4A
6tqoT Rrn anti-termination complex (see paper)
30% identity, 85% coverage: 4:223/259 of query aligns to 5:224/255 of 6tqoT
>CCNA_00310 FitnessBrowser__Caulo:CCNA_00310
MNDLDLIIAAAREAGELALGARESGLTIWSKEGGSPVTDADLAVDTLLRTELRAERPDYG
WLSEETADDPARLATGRQFVVDPIDGTVAFMKGKPWFAVSIAVVEDGQPIAAVVHAPALD
ETYAATLQGPATLNGAPIAPSDTDALEGAAMLGDAKMFAHPAWREPWPTMRIETRNSIAY
RACLVAAGAFDAAVALSPKSEWDVAAADLICQRAGAALSDHKGRPYAYNRPVPQVPSLVC
ANRALAPLILNRVGHIELP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory