Comparing CCNA_00316 FitnessBrowser__Caulo:CCNA_00316 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
45% identity, 96% coverage: 12:373/377 of query aligns to 2:362/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
44% identity, 96% coverage: 12:373/377 of query aligns to 4:364/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
40% identity, 96% coverage: 12:373/377 of query aligns to 2:322/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 96% coverage: 12:373/377 of query aligns to 2:320/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
34% identity, 59% coverage: 13:234/377 of query aligns to 1:206/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
31% identity, 69% coverage: 2:261/377 of query aligns to 2:251/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 50% coverage: 2:188/377 of query aligns to 2:182/236 of 7f5xA
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
39% identity, 23% coverage: 158:244/377 of query aligns to 121:202/226 of 2bmuB
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
39% identity, 23% coverage: 158:244/377 of query aligns to 120:201/225 of Q8U122
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
43% identity, 13% coverage: 158:206/377 of query aligns to 122:167/219 of 2ji5A
Sites not aligning to the query:
3ll5A Crystal structure of t. Acidophilum isopentenyl phosphate kinase product complex (see paper)
38% identity, 15% coverage: 137:194/377 of query aligns to 122:180/233 of 3ll5A
Sites not aligning to the query:
3lkkB Crystal structure of the isopentenyl phosphate kinase substrate complex (see paper)
38% identity, 15% coverage: 137:194/377 of query aligns to 123:181/238 of 3lkkB
Sites not aligning to the query:
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
31% identity, 22% coverage: 120:203/377 of query aligns to 167:254/468 of 3c1mC
Sites not aligning to the query:
>CCNA_00316 FitnessBrowser__Caulo:CCNA_00316
MTSGSQGAFEAARRIVFKVGSALLVDAETGAANRAWLEAFCADAADLRAAGKQVLVVSSG
AVALGRRRLGLTGRKTTLPEKQAAAAAGQSLLMRAWEEAFEPHGIGVAQILLTRDDTEMR
RRWLNARATTETLMGLGVVPVVNENDTVVTEEIRYGDNDRLAARVAQMAGADLLVLLSDI
DGLYTADPRKNPKAQHIPRVSEITPEIAGMAEGANAAAGVGTGGMATKIAAARIARAAGC
ATLITLGSRPRPLAAIAAGEKATLIEAGASPAAAYKAWIAGSLAPQGWVTVDAGAASALL
AGKSLLPAGVRAVEGPFDKGDAVRVRDENGREVARGLVRYDSADAQRIAGLRSDAIEAEL
GFTEGPMIHADDLAVAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory