SitesBLAST
Comparing CCNA_00365 FitnessBrowser__Caulo:CCNA_00365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O50657 Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 from Selenomonas ruminantium (see paper)
34% identity, 80% coverage: 43:378/419 of query aligns to 46:375/393 of O50657
- P54 (= P51) mutation to D: 3-fold increase in substrate specificity towards ornithine. 5-fold increase in substrate specificity towards ornithine; when associated with 44-V--P-46. 70-fold increase in substrate specificity towards ornithine; when associated with 44-V--P-46 and A-322. 16-fold increase in substrate specificity towards ornithine; when associated with 44-V--P-46; T-322 and L-326.
- G319 (≠ Y321) mutation to W: 7-fold increase in substrate specificity towards ornithine.
- S322 (≠ T324) mutation to A: 29-fold increase in substrate specificity towards ornithine. 70-fold increase in substrate specificity towards ornithine; when associated with 44-V--P-46 and D-54.; mutation to T: 16-fold increase in substrate specificity towards ornithine; when associated with L-326. 16-fold increase in substrate specificity towards ornithine; when associated with 44-V--P-46; D-54 and L-326.
- I326 (≠ V328) mutation to L: 16-fold increase in substrate specificity towards ornithine; when associated with T-322. 16-fold increase in substrate specificity towards ornithine; when associated with 44-V--P-46; D-54 and T-322.
- G350 (= G353) mutation to D: Loss of dimer formation and decarboxylase activity.
Sites not aligning to the query:
- 44:46 AGV→VTP: 2-fold increase in substrate specificity towards ornithine. 5-fold increase in substrate specificity towards ornithine; when associated with D-54. 70-fold increase in substrate specificity towards ornithine; when associated with D-54 and A-322. 16-fold increase in substrate specificity towards ornithine; when associated with D-54; T-322 and L-326.
5gjoA Crystal structure of srldc mutant (a225c/t302c) in complex with plp (see paper)
34% identity, 80% coverage: 43:378/419 of query aligns to 47:376/385 of 5gjoA
- active site: K52 (= K48), H180 (= H180), E256 (= E255)
- binding pyridoxal-5'-phosphate: A50 (= A46), K52 (= K48), D71 (= D68), H180 (= H180), S183 (= S183), G219 (= G216), G220 (= G217), E256 (= E255), G258 (= G257), R259 (= R258), Y353 (= Y355)
5gjnA Crystal structure of lysine decarboxylase from selenomonas ruminantium in p43212 space group (see paper)
33% identity, 80% coverage: 43:378/419 of query aligns to 46:364/369 of 5gjnA
5gjpA Crystal structure of srldc in complex with plp and cadaverine (see paper)
33% identity, 80% coverage: 43:378/419 of query aligns to 46:367/381 of 5gjpA
- active site: K51 (= K48), H171 (= H180), E247 (= E255)
- binding pentane-1,5-diamine: Y290 (≠ H294), D291 (≠ M295), Y344 (= Y355)
- binding pyridoxal-5'-phosphate: A49 (= A46), K51 (= K48), H171 (= H180), S174 (= S183), G211 (= G217), E247 (= E255), G249 (= G257), R250 (= R258), Y344 (= Y355)
2oo0A A structural insight into the inhibition of human and leishmania donovani ornithine decarboxylases by 3-aminooxy-1-aminopropane (see paper)
33% identity, 83% coverage: 33:378/419 of query aligns to 64:409/419 of 2oo0A
- active site: K79 (= K48), H207 (= H180), E284 (= E255)
- binding pentane-1,5-diamine: P249 (= P219), G250 (≠ S220), S251 (≠ I221), V254 (vs. gap), R287 (= R258), N382 (≠ M351)
- binding pyridoxal-5'-phosphate: A77 (= A46), K79 (= K48), D98 (= D68), H207 (= H180), S210 (= S183), G247 (= G217), E284 (= E255), G286 (= G257), R287 (= R258), Y386 (= Y355)
- binding 3-aminooxy-1-aminopropane: C174 (≠ Y147), D329 (= D291), Y386 (= Y355)
7u6pA Structure of an intellectual disability-associated ornithine decarboxylase variant g84r (see paper)
33% identity, 83% coverage: 33:378/419 of query aligns to 54:399/409 of 7u6pA
P11926 Ornithine decarboxylase; ODC; EC 4.1.1.17 from Homo sapiens (Human) (see 5 papers)
32% identity, 83% coverage: 33:378/419 of query aligns to 54:412/461 of P11926
- K69 (= K48) modified: N6-(pyridoxal phosphate)lysine
- S200 (= S183) binding
- G237 (= G217) binding
- EPGR 274:277 (= EPGR 255:258) binding
- C360 (= C325) mutation to A: 25% decrease of in vitro nitrosylation level.
- Y389 (= Y355) binding
Sites not aligning to the query:
- 448:461 natural variant: Missing (in BABS; gain-of-function variant resulting in increased putrescine biosynthesis as indicated by higher amount of putrescine in patient red blood cells compared to controls; increased ODC1 protein levels in patient red blood cells)
P00860 Ornithine decarboxylase; ODC; EC 4.1.1.17 from Mus musculus (Mouse) (see 5 papers)
32% identity, 83% coverage: 33:379/419 of query aligns to 54:413/461 of P00860
- K69 (= K48) modified: N6-(pyridoxal phosphate)lysine
- G237 (= G217) binding
- EPGR 274:277 (= EPGR 255:258) binding
- S303 (vs. gap) modified: Phosphoserine; by CK2
- C360 (= C325) active site, Proton donor; shared with dimeric partner
- G387 (= G353) mutation to A: Partial loss of activity.; mutation G->C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y: Loss of activity.
- Y389 (= Y355) binding
4zgyA Structure of human ornithine decarboxylase in complex with a c- terminal fragment of antizyme (see paper)
33% identity, 83% coverage: 33:378/419 of query aligns to 30:374/383 of 4zgyA
- active site: K45 (= K48), H170 (= H180), E247 (= E255)
- binding magnesium ion: G210 (= G217), F211 (= F218), R250 (= R258), Y251 (≠ A259)
- binding pyridoxal-5'-phosphate: K45 (= K48), D64 (= D68), H170 (= H180), G210 (= G217), E247 (= E255), G249 (= G257), R250 (= R258), Y353 (= Y355)
2pljA Crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus (see paper)
31% identity, 85% coverage: 19:376/419 of query aligns to 30:374/376 of 2pljA
- active site: K60 (= K48), H179 (= H180), E255 (= E255)
- binding (4-{[(4-aminobutyl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: K60 (= K48), H179 (= H180), S182 (= S183), G220 (= G217), E255 (= E255), G257 (= G257), R258 (= R258), D299 (= D291), Y353 (= Y355)
2plkA Crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus (see paper)
31% identity, 85% coverage: 19:376/419 of query aligns to 26:369/370 of 2plkA
1f3tB Crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product. (see paper)
32% identity, 77% coverage: 44:366/419 of query aligns to 46:359/381 of 1f3tB
- active site: K50 (= K48), H171 (= H180), E248 (= E255)
- binding pyridoxal-5'-phosphate: K50 (= K48), R135 (= R137), H171 (= H180), G210 (= G216), G211 (= G217), E248 (= E255), G250 (= G257), R251 (= R258), Y348 (= Y355)
- binding 1,4-diaminobutane: D291 (= D291), Y348 (= Y355)
P07805 Ornithine decarboxylase; ODC; EC 4.1.1.17 from Trypanosoma brucei brucei (see 3 papers)
31% identity, 77% coverage: 44:366/419 of query aligns to 63:398/423 of P07805
- K67 (= K48) modified: N6-(pyridoxal phosphate)lysine
- S198 (= S183) binding
- G235 (= G217) binding
- EPGR 272:275 (= EPGR 255:258) binding
- YD 329:330 (≠ FD 290:291) binding in other chain
- C358 (= C325) active site, Proton donor; shared with dimeric partner; mutation C->S,A: Converts the enzyme into a decarboxylation-dependent transaminase, producing gamma-aminobutyaldehyde (gamma-ABA) and pyridoxamine 5-phosphate (PMP) instead of putrescine.
- D359 (= D326) binding
- Y387 (= Y355) binding
2todA Ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine (see paper)
31% identity, 77% coverage: 44:366/419 of query aligns to 29:343/353 of 2todA
- active site: A33 (≠ K48), H153 (= H180), E230 (= E255)
- binding alpha-difluoromethylornithine: D275 (= D291), C303 (= C325), D304 (= D326), Y332 (= Y355), F340 (= F363)
- binding pyridoxal-5'-phosphate: H153 (= H180), S156 (= S183), G192 (= G216), G193 (= G217), E230 (= E255), G232 (= G257), R233 (= R258), Y332 (= Y355)
1szrC A dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate (see paper)
31% identity, 77% coverage: 44:366/419 of query aligns to 29:339/347 of 1szrC
2nv9B The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase (see paper)
30% identity, 79% coverage: 45:374/419 of query aligns to 45:372/372 of 2nv9B
- active site: K48 (= K48), H176 (= H180), E252 (= E255)
- binding pyridoxal-5'-phosphate: K48 (= K48), D67 (= D68), H176 (= H180), S179 (= S183), G215 (= G216), G216 (= G217), E252 (= E255), G254 (= G257), R255 (= R258), Y353 (= Y355)
2nvaA The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase bound to agmatine (see paper)
31% identity, 79% coverage: 45:374/419 of query aligns to 45:369/369 of 2nvaA
- active site: K48 (= K48), H176 (= H180), E249 (= E255)
- binding (4-{[(4-{[amino(imino)methyl]amino}butyl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: D67 (= D68), L145 (= L149), H176 (= H180), S179 (= S183), G215 (= G216), G216 (= G217), E249 (= E255), G251 (= G257), R252 (= R258), E293 (≠ M295), C321 (= C325), D322 (= D326), Y350 (= Y355)
1szrA A dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate (see paper)
30% identity, 77% coverage: 44:366/419 of query aligns to 29:336/345 of 1szrA
1njjA Crystal structure determination of t. Brucei ornithine decarboxylase bound to d-ornithine and to g418 (see paper)
31% identity, 75% coverage: 44:358/419 of query aligns to 38:337/349 of 1njjA
- active site: K42 (= K48), H160 (= H180), E237 (= E255)
- binding geneticin: D206 (≠ P223), L287 (≠ F299), L327 (≠ E348), E329 (≠ G350), D330 (≠ M351)
- binding n~2~-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-ornithine: A40 (= A46), K42 (= K48), H160 (= H180), G199 (= G216), G200 (= G217), E237 (= E255), G239 (= G257), R240 (= R258), Y279 (≠ F290), D280 (= D291), Y334 (= Y355)
Sites not aligning to the query:
Q8BVM4 Antizyme inhibitor 2; AzI2; Arginine decarboxylase-like protein; ADC; ARGDC; Ornithine decarboxylase-like protein; ODC-like protein; ornithine decarboxylase paralog; ODC-p from Mus musculus (Mouse) (see paper)
28% identity, 77% coverage: 44:365/419 of query aligns to 66:399/459 of Q8BVM4
- K116 (= K94) mutation to A: Does not inhibit interaction with OAZ1. Reduces interaction with OAZ1; when associated with A-142.
- A124 (= A102) mutation to S: Does not inhibit interaction with OAZ1.
- E139 (= E118) mutation to A: Strongly reduces interaction with OAZ1 and unable to abrogate both the inhibitory effect of OAZ1 on ornithine decarboxylase (ODC) activity and polyamine uptake; when associated with A-140 and A-142.
- L140 (= L119) mutation to A: Strongly reduces interaction with OAZ1 and unable to abrogate both the inhibitory effect of OAZ1 on ornithine decarboxylase (ODC) activity and polyamine uptake; when associated with A-139 and A-142.
- K142 (= K121) mutation to A: Does not inhibit interaction with OAZ1. Reduces interaction with OAZ1; when associated with A-116. Strongly reduces interaction with OAZ1 and unable to abrogate the inhibitory effect of OAZ1 on ornithine decarboxylase (ODC) activity and polyamine uptake; when associated with A-139 and A-140.
Query Sequence
>CCNA_00365 FitnessBrowser__Caulo:CCNA_00365
MRTYHSPLDLVRERSPERPVALVRPDAVAVAARWFQSEFKGDVFYAVKANPSPWVIRELA
KAGVRSFDVASLNEVELVANEAPGSRMAFMHPVKSRAAISAAYFDHGVKTFSFDTHEELA
KILDATGQAKDLNLIVRMGVQAEGAAYSLSGKFGVEMHNAPDLLLAARRATQDLMGVSFH
VGSQCMRPTAFQAAMAQASRALVRAGVLADVVDVGGGFPSIYPGMVPPDLSEYLAAIDRG
FAEMMVHETTELWCEPGRALVAEASSLLVKVELKKGDALYLNDGSYGSLFDAAHMKWPFP
VKLYRKSGEVVEEGLKPFRFYGPTCDSVDHMPGPFYLPESVDEGDYIEIGMLGAYGVAMN
TRFNGFGETDTAQVQDAPMASMYGLAKRSIPVVRQETEERKIVRFSRPKGAAGKRKRRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory