Comparing CCNA_00366 FitnessBrowser__Caulo:CCNA_00366 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 90% coverage: 5:241/264 of query aligns to 1:223/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 89% coverage: 6:241/264 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 89% coverage: 6:241/264 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 89% coverage: 6:241/264 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 89% coverage: 6:241/264 of query aligns to 3:225/242 of 2oljA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 80% coverage: 21:231/264 of query aligns to 20:222/232 of 1f3oA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 89% coverage: 6:241/264 of query aligns to 1:223/240 of 4ymuJ
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 80% coverage: 21:231/264 of query aligns to 20:222/230 of 1l2tA
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 89% coverage: 6:241/264 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 89% coverage: 6:241/264 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 89% coverage: 6:241/264 of query aligns to 2:229/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 89% coverage: 6:241/264 of query aligns to 2:229/344 of 6cvlD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 80% coverage: 20:230/264 of query aligns to 21:218/226 of 5xu1B
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 91% coverage: 5:244/264 of query aligns to 16:238/378 of P69874
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 94% coverage: 3:251/264 of query aligns to 8:246/265 of P07821
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
34% identity, 90% coverage: 6:242/264 of query aligns to 3:230/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
34% identity, 90% coverage: 6:242/264 of query aligns to 3:230/592 of 5lj7A
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
34% identity, 87% coverage: 6:235/264 of query aligns to 2:220/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
34% identity, 87% coverage: 6:235/264 of query aligns to 2:220/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
34% identity, 87% coverage: 6:235/264 of query aligns to 1:219/229 of A5U7B7
>CCNA_00366 FitnessBrowser__Caulo:CCNA_00366
MTSDPVLSIRAASKTFGSRRALDAVSLDVNRGEMIALIGPSGSGKSTLLRSIDGLQTIDE
GEGAITAFGGPVQARGKVSDQVRKARVRIGFIAQQFNLVGRLSLFSNVALGSLGRIPVVQ
GLLGWWPKETRDATMAALHRVGVSEYAAQRANTLSGGQQQRGAIARALVQKAKIILADEP
VASLDPVSARKVMEILRDLNQSDGLTVVVTLHQVDYALRYCDRVVALKAGQKVYDGPASE
LKREKLIDIYGPEFEDVFWEGAPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory