SitesBLAST
Comparing CCNA_00436 FitnessBrowser__Caulo:CCNA_00436 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
40% identity, 99% coverage: 1:379/382 of query aligns to 1:378/378 of 5ol2F
- active site: L124 (= L124), T125 (= T125), G241 (= G242), G374 (≠ R375)
- binding calcium ion: E29 (≠ Q29), E33 (≠ N33), R35 (≠ A35)
- binding coenzyme a persulfide: L238 (= L239), R242 (= R243), E362 (= E363), G363 (= G364)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), T125 (= T125), P127 (= P127), T131 (≠ S131), F155 (≠ Y155), I156 (= I156), T157 (= T157), E198 (= E199), R267 (= R268), F270 (= F271), L274 (≠ I275), F277 (= F278), Q335 (= Q336), L336 (≠ V337), G338 (= G339), G339 (= G340), Y361 (= Y362), T364 (= T365), E366 (≠ Q367)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
43% identity, 98% coverage: 4:376/382 of query aligns to 4:377/378 of 4n5fA
- active site: L126 (= L124), T127 (= T125), G243 (= G242), E364 (= E363), R376 (= R375)
- binding dihydroflavine-adenine dinucleotide: L126 (= L124), T127 (= T125), G132 (= G130), S133 (= S131), F157 (≠ Y155), T159 (= T157), T210 (≠ I209), Y363 (= Y362), T366 (= T365), E368 (≠ Q367), M372 (≠ L371)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
40% identity, 98% coverage: 5:378/382 of query aligns to 1:373/374 of 5lnxD
- active site: L122 (= L124), T123 (= T125), G239 (= G242), E358 (= E363), K370 (≠ R375)
- binding flavin-adenine dinucleotide: L122 (= L124), T123 (= T125), G128 (= G130), S129 (= S131), F153 (≠ Y155), T155 (= T157), R265 (= R268), Q267 (= Q270), F268 (= F271), I272 (= I275), N275 (≠ F278), I278 (= I281), Q331 (= Q336), I332 (≠ V337), G335 (= G340), Y357 (= Y362), T360 (= T365), E362 (≠ Q367)
4m9aB Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
42% identity, 98% coverage: 4:376/382 of query aligns to 2:375/376 of 4m9aB
- active site: L124 (= L124), T125 (= T125), G241 (= G242), E362 (= E363), R374 (= R375)
- binding dihydroflavine-adenine dinucleotide: F122 (= F122), T125 (= T125), G130 (= G130), S131 (= S131), F155 (≠ Y155), T157 (= T157), T208 (≠ I209), Y361 (= Y362), T364 (= T365), E366 (≠ Q367), M370 (≠ L371)
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
40% identity, 98% coverage: 6:379/382 of query aligns to 8:381/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (= S131), T134 (≠ S133), R180 (≠ A179), R234 (≠ K233), L237 (≠ M236), R238 (≠ Q237), L240 (= L239), D241 (= D240), R244 (= R243), E365 (= E363), G366 (= G364), R377 (= R375)
- binding flavin-adenine dinucleotide: Y123 (≠ F122), L125 (= L124), S126 (≠ T125), G131 (= G130), S132 (= S131), W156 (≠ Y155), I157 (= I156), T158 (= T157), I360 (= I358), T367 (= T365), Q369 (= Q367)
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
40% identity, 98% coverage: 6:379/382 of query aligns to 8:381/381 of 8i4pA
- binding flavin-adenine dinucleotide: Y123 (≠ F122), L125 (= L124), S126 (≠ T125), G131 (= G130), S132 (= S131), W156 (≠ Y155), I157 (= I156), T158 (= T157), I360 (= I358), Y364 (= Y362), T367 (= T365), Q369 (= Q367)
7w0jE Acyl-coa dehydrogenase, tfu_1647
40% identity, 98% coverage: 6:379/382 of query aligns to 9:382/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ T125), W157 (≠ Y155), R270 (= R268), Q272 (= Q270), F273 (= F271), I277 (= I275), F280 (= F278), I283 (= I281), Q339 (= Q336), L340 (≠ V337), G343 (= G340), Y365 (= Y362), E366 (= E363), T368 (= T365), Q370 (= Q367), I371 (≠ V368)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
40% identity, 98% coverage: 6:378/382 of query aligns to 7:377/379 of 1ukwB
- active site: L124 (= L124), S125 (≠ T125), T241 (≠ G242), E362 (= E363), R374 (= R375)
- binding cobalt (ii) ion: D145 (= D145), H146 (≠ D146)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ Y155), S157 (≠ T157), K200 (= K201), L357 (≠ I358), Y361 (= Y362), E362 (= E363), T364 (= T365), E366 (≠ Q367), L370 (= L371)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
40% identity, 98% coverage: 6:378/382 of query aligns to 7:377/379 of 1ukwA
- active site: L124 (= L124), S125 (≠ T125), T241 (≠ G242), E362 (= E363), R374 (= R375)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ Y155), S157 (≠ T157), L357 (≠ I358), Y361 (= Y362), E362 (= E363), T364 (= T365), E366 (≠ Q367), L370 (= L371)
8phfA Cryo-em structure of human acad9-s191a (see paper)
39% identity, 99% coverage: 4:382/382 of query aligns to 26:408/547 of 8phfA
- binding flavin-adenine dinucleotide: T144 (= T125), W176 (≠ Y155), K225 (= K201), R292 (= R268), Q294 (= Q270), F295 (= F271), F302 (= F278), L304 (= L280), I305 (= I281), I363 (≠ V337), G365 (= G339), G366 (= G340), F388 (≠ Y362), E393 (≠ Q367), M397 (≠ L371)
Sites not aligning to the query:
8pheA Acad9-wt in complex with ecsit-cter (see paper)
39% identity, 99% coverage: 4:382/382 of query aligns to 26:408/551 of 8pheA
- binding : L143 (= L124), D151 (= D132), A153 (= A134), S154 (≠ A135), I155 (≠ V136), K202 (≠ G178), I205 (≠ V181), F256 (= F232), M260 (= M236), F295 (= F271), N296 (≠ G272), I394 (≠ V368), Y398 (≠ I372), L401 (≠ R375), Q405 (≠ K379)
Sites not aligning to the query:
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
41% identity, 95% coverage: 17:379/382 of query aligns to 9:369/369 of 3pfdC
- active site: L116 (= L124), S117 (≠ T125), T233 (≠ G242), E353 (= E363), R365 (= R375)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ F122), L116 (= L124), S117 (≠ T125), G122 (= G130), S123 (= S131), W147 (≠ Y155), I148 (= I156), T149 (= T157), R259 (= R268), F262 (= F271), V266 (≠ I275), N269 (≠ F278), Q326 (= Q336), L327 (≠ V337), G330 (= G340), I348 (= I358), Y352 (= Y362), T355 (= T365), Q357 (= Q367)
Q9H845 Complex I assembly factor ACAD9, mitochondrial; Acyl-CoA dehydrogenase family member 9; ACAD-9; EC 1.3.8.- from Homo sapiens (Human) (see 4 papers)
39% identity, 99% coverage: 4:382/382 of query aligns to 63:445/621 of Q9H845
- R193 (≠ Q137) to W: in MC1DN20; uncertain significance; dbSNP:rs377547811
- S234 (≠ P173) to F: in MC1DN20; uncertain significance
- G303 (= G242) to S: in MC1DN20; uncertain significance; dbSNP:rs143383023
- A326 (= A265) to T: in MC1DN20; uncertain significance; dbSNP:rs115532916
- E413 (= E350) to K: in MC1DN20; uncertain significance; dbSNP:rs149753643
- E426 (= E363) mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. Does not affect mitochondrial complex I assembly.
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
40% identity, 99% coverage: 1:379/382 of query aligns to 1:379/380 of 4l1fA
- active site: L125 (= L124), T126 (= T125), G242 (= G242), E363 (= E363), R375 (= R375)
- binding coenzyme a persulfide: T132 (≠ S131), H179 (≠ A179), F232 (= F232), M236 (= M236), E237 (≠ Q237), L239 (= L239), D240 (= D240), R243 (= R243), Y362 (= Y362), E363 (= E363), G364 (= G364), R375 (= R375)
- binding flavin-adenine dinucleotide: F123 (= F122), L125 (= L124), T126 (= T125), G131 (= G130), T132 (≠ S131), F156 (≠ Y155), I157 (= I156), T158 (= T157), R268 (= R268), Q270 (= Q270), F271 (= F271), I275 (= I275), F278 (= F278), L281 (≠ I281), Q336 (= Q336), I337 (≠ V337), G340 (= G340), I358 (= I358), Y362 (= Y362), T365 (= T365), Q367 (= Q367)
- binding 1,3-propandiol: L5 (= L5), Q10 (= Q10)
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
40% identity, 98% coverage: 9:382/382 of query aligns to 7:380/383 of 4iv6B
- active site: L121 (= L124), T122 (= T125), G240 (= G242), E361 (= E363), K373 (≠ R375)
- binding dihydroflavine-adenine dinucleotide: L121 (= L124), T122 (= T125), G126 (≠ A129), G127 (= G130), S128 (= S131), W152 (≠ Y155), I153 (= I156), S154 (≠ T157), R266 (= R268), S268 (≠ Q270), F269 (= F271), I273 (= I275), H276 (≠ F278), V279 (≠ I281), R334 (≠ Q336), V335 (= V337), G338 (= G340), L356 (≠ I358), G360 (≠ Y362), T363 (= T365), E365 (≠ Q367), I366 (≠ V368)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
40% identity, 98% coverage: 6:379/382 of query aligns to 36:408/412 of P16219
- G90 (= G60) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E74) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 122:131, 70% identical) binding in other chain
- R171 (≠ T141) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ YIT 155:157) binding in other chain
- A192 (= A162) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G180) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R268) binding
- Q308 (= Q279) binding in other chain
- R325 (≠ K296) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (= S324) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QVFGG 336:340) binding
- R380 (= R351) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (≠ TSQ 365:367) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
40% identity, 98% coverage: 6:379/382 of query aligns to 9:381/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ A341), T347 (≠ A345), E348 (≠ D346)
- binding flavin-adenine dinucleotide: F125 (= F122), L127 (= L124), S128 (≠ T125), G133 (= G130), S134 (= S131), W158 (≠ Y155), T160 (= T157), R270 (= R268), F273 (= F271), L280 (≠ F278), V282 (≠ L280), Q338 (= Q336), I339 (≠ V337), G342 (= G340), I360 (= I358), Y364 (= Y362), T367 (= T365), E369 (≠ Q367), I370 (≠ V368), L373 (= L371)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
40% identity, 98% coverage: 6:379/382 of query aligns to 12:384/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (= F122), L130 (= L124), S131 (≠ T125), G136 (= G130), S137 (= S131), W161 (≠ Y155), T163 (= T157), T214 (≠ I209), R273 (= R268), F276 (= F271), L280 (≠ I275), L283 (≠ F278), V285 (≠ L280), Q341 (= Q336), I342 (≠ V337), G345 (= G340), I363 (= I358), Y367 (= Y362), T370 (= T365), E372 (≠ Q367), L376 (= L371)
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
40% identity, 98% coverage: 6:379/382 of query aligns to 6:378/381 of 8sgsA
- binding coenzyme a: S131 (= S131), A133 (≠ S133), N177 (≠ G178), F231 (= F232), M235 (= M236), L238 (= L239), I312 (≠ T313), E362 (= E363), G363 (= G364)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ Y155), T157 (= T157), R267 (= R268), F270 (= F271), L274 (≠ I275), L277 (≠ F278), Q335 (= Q336), I336 (≠ V337), G338 (= G339), G339 (= G340), I357 (= I358), I360 (= I361), Y361 (= Y362), T364 (= T365), E366 (≠ Q367)
Q9VSA3 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; EC 1.3.8.7 from Drosophila melanogaster (Fruit fly) (see paper)
39% identity, 97% coverage: 6:375/382 of query aligns to 39:409/419 of Q9VSA3
- S347 (≠ T313) modified: Phosphoserine; by Pink1; mutation to A: Prevents phosphorylation by Pink1. Does not rescue climbing and flight defects in Pink1 mutants.; mutation to D: Phosphomimetic mutant that fully rescues climbing defects and significantly improves flight defects, and thorax and wing posture phenotypes in Pink1 mutants. No effect on acyl-CoA dehydrogenase activity.; mutation to DD: Phosphomimetic mutant that fully rescues climbing defects and significantly improves flight defects, and thorax and wing posture phenotypes in Pink1 mutants. No effect on acyl-CoA dehydrogenase activity.
Query Sequence
>CCNA_00436 FitnessBrowser__Caulo:CCNA_00436
MALDLETREQLIDTVARFVAERLRPIEAQVAENDAVPDDVIEEMKGLGLFGLTIPEEFGG
LGLTMEEEALVAIELGRASPAFRSVFGTNVGIGSQGLVMFGNDEQKAKWLPGIASGAVIT
SFALTEPEAGSDSAAVQTRATRDGDDYILNGSKRYITNAGKASLFTVMARTNPDAKGGAG
VSAFLVPRDLPGLTVGKPEKKMGQQGAHIHDVTFDNVRVPAWNRLGAEGEGFKVAMQVLD
RGRLHIAAVCVGVAERLIADCVAYASERKQFGQPIASFQLIQAMIADSKTEALAAKALVL
ETARKRDAGVNVTLEAASSKLFASEMVGRVADRAVQVFGGAGYVADYGIERLYRDVRIFR
IYEGTSQVQQLIIARETLKRGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory