Comparing CCNA_00457 FitnessBrowser__Caulo:CCNA_00457 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 65% coverage: 289:840/852 of query aligns to 1:566/575 of P08839
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
39% identity, 65% coverage: 290:840/852 of query aligns to 1:565/572 of 2hwgA
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
33% identity, 65% coverage: 290:845/852 of query aligns to 5:572/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
35% identity, 65% coverage: 289:841/852 of query aligns to 3:568/570 of 2wqdA
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 35% coverage: 539:840/852 of query aligns to 5:311/317 of 2xz9A
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 35% coverage: 539:840/852 of query aligns to 12:318/324 of 2xz7A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
31% identity, 45% coverage: 420:805/852 of query aligns to 409:841/850 of 5lu4A
Sites not aligning to the query:
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
28% identity, 38% coverage: 174:500/852 of query aligns to 160:462/472 of P37349
Sites not aligning to the query:
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
46% identity, 15% coverage: 2:128/852 of query aligns to 9:135/161 of 1glcF
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
29% identity, 45% coverage: 420:805/852 of query aligns to 336:786/797 of 5jvjB
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
29% identity, 45% coverage: 420:805/852 of query aligns to 488:942/953 of Q39735
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
29% identity, 45% coverage: 420:805/852 of query aligns to 409:863/874 of 5jvlA
Sites not aligning to the query:
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
46% identity, 14% coverage: 8:128/852 of query aligns to 23:143/169 of P69783
Sites not aligning to the query:
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
46% identity, 14% coverage: 8:128/852 of query aligns to 4:124/150 of 1o2fA
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
27% identity, 43% coverage: 436:805/852 of query aligns to 424:859/872 of 1kc7A
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
27% identity, 43% coverage: 436:805/852 of query aligns to 425:860/874 of P22983
Sites not aligning to the query:
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
43% identity, 15% coverage: 8:133/852 of query aligns to 501:626/648 of P09323
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 43% coverage: 436:805/852 of query aligns to 515:951/963 of O23404
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
30% identity, 30% coverage: 547:805/852 of query aligns to 180:509/520 of 5jvlB
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
28% identity, 40% coverage: 435:777/852 of query aligns to 425:835/874 of 1vbgA
Sites not aligning to the query:
>CCNA_00457 FitnessBrowser__Caulo:CCNA_00457
MIVSNLVLTAPLQGWVSALEEAPDAVFAERMLGDGLAIDPLGSTLHAPCDGSVVSVHRAR
HAVTLRATNGAEILMHVGLETVALNGEGFEVFVEEGQTVKAGDRLIGLDLDLLAQRARSL
ITPVVITNGEAFQIVRRDQDRQIGVGQFLMELSPIAGASRAAASGAADQITRQIIVPLAH
GIHARPAARIAQMAKTFASDLTLATGPRRANARSPVGLMSLAIRHGDTIQLLASGPDAQA
AVTALAELIEGGMGEGAPVAAKTSSTKTAPTKTEPSEPPPPAPLPRDGVLKGVPAAPGLA
IGKAVRLSTAEIVVREAGEGVAHEEAALAVALETVRARIGKAAETGDKARKAILAAHQAF
LDDPELYAGAHRLIAEGKSAGFAWRRAVGGYVQALQALGDRRMAERVDDLIDLERQVLRA
LSGEEETGAALAPGSILLADELLPSQLMGADPAALAGFATARGGPTSHVAILAAAMGVPA
LVAVGGALSKVKDGATLILDADAGTLRVAPDAKALEAAQTALAQRQQRKAAAKAAAHEPA
VTRDGVRIEVFANTGSVADAQAAVANGAEGSGLLRTEFLFLDRETPPDEDEQARQYQAIA
EALDGRPLIIRTLDVGGDKAAPYLPIPAEENPALGLRGVRVSLWRPHLLKAQLRAILRVE
PRGQCKIMVPMVASLDELRAVRAVLEEAKRELGITDRVQLGVMIETPAAAVTADLLAAEA
DFLSIGTNDLTQYVLAMDRGNPELAAGIDALHPAVLRMIDQTCQGAARHHRWVGVCGGLA
SDLDATPILLGLGVAELSTTASIAPDVKARVRALSLEACRALAAQALEQTSPQAVRALVQ
GQTNTPLGGLNP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory