Comparing CCNA_00553 FitnessBrowser__Caulo:CCNA_00553 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
43% identity, 99% coverage: 2:247/249 of query aligns to 70:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
44% identity, 96% coverage: 10:247/249 of query aligns to 8:254/254 of 2q42A
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
46% identity, 95% coverage: 11:247/249 of query aligns to 11:259/259 of 8ewoA
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 99% coverage: 3:249/249 of query aligns to 1:258/258 of O24496
6rz0A Crystal structure of escherichia coli glyoxalase ii
38% identity, 98% coverage: 3:247/249 of query aligns to 1:251/251 of 6rz0A
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
34% identity, 99% coverage: 2:247/249 of query aligns to 1:252/252 of 2qedA
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 95% coverage: 11:247/249 of query aligns to 9:251/251 of Q8ZRM2
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
34% identity, 99% coverage: 3:248/249 of query aligns to 1:256/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
34% identity, 99% coverage: 3:248/249 of query aligns to 1:256/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
34% identity, 99% coverage: 3:248/249 of query aligns to 1:256/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
34% identity, 99% coverage: 3:248/249 of query aligns to 49:304/308 of Q16775
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
32% identity, 89% coverage: 2:222/249 of query aligns to 12:258/283 of 2p18A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
34% identity, 79% coverage: 8:204/249 of query aligns to 7:197/225 of 4ysbA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 59% coverage: 27:172/249 of query aligns to 69:234/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
32% identity, 59% coverage: 27:172/249 of query aligns to 20:185/244 of 2gcuA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
31% identity, 55% coverage: 34:170/249 of query aligns to 34:192/210 of 2xf4A
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
30% identity, 63% coverage: 17:172/249 of query aligns to 20:218/295 of 4efzA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
28% identity, 68% coverage: 3:172/249 of query aligns to 24:197/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
28% identity, 68% coverage: 3:172/249 of query aligns to 8:181/237 of 4chlB
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
31% identity, 62% coverage: 17:170/249 of query aligns to 18:198/473 of 3tp9A
>CCNA_00553 FitnessBrowser__Caulo:CCNA_00553
MALTVHQFRCLSDNYGFLVRDEASGKVATIDTPDAGAILAELAKLGWSLDLILNTHWHPD
HAGGNETLKTATGATIVGPAEVTRIAPLDRVVRDGEEVMLGDTRLTVIDTGGHTLGHVSY
YDAEDAIAFVGDTLFALGCGRLFEGTAEQMWDSLGRLIALPDETTVYCAHEYTASNARFA
LSVDSSAALAARAEAVFAARARDEATVPTTIGVEKATNPFLRAPLLRPDAPSPAQAFAEI
RAAKDSFKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory