Comparing CCNA_00559 FitnessBrowser__Caulo:CCNA_00559 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
47% identity, 93% coverage: 16:372/382 of query aligns to 15:372/387 of Q6FEQ3
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
47% identity, 89% coverage: 21:360/382 of query aligns to 12:343/358 of P45131
Sites not aligning to the query:
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
42% identity, 78% coverage: 13:310/382 of query aligns to 80:373/504 of Q10341
Sites not aligning to the query:
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
40% identity, 93% coverage: 23:378/382 of query aligns to 18:367/368 of 7rytB
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
40% identity, 93% coverage: 23:378/382 of query aligns to 18:367/367 of 8f2lA
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
40% identity, 88% coverage: 23:360/382 of query aligns to 9:330/346 of 5w8oB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
41% identity, 88% coverage: 23:360/382 of query aligns to 19:350/366 of 6puxA
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
40% identity, 91% coverage: 28:373/382 of query aligns to 23:371/374 of D2Z028
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
38% identity, 93% coverage: 23:377/382 of query aligns to 19:367/375 of 6iohA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
38% identity, 93% coverage: 23:376/382 of query aligns to 19:366/366 of 6ioiA
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
34% identity, 91% coverage: 25:372/382 of query aligns to 20:345/347 of 2vatA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
34% identity, 91% coverage: 25:372/382 of query aligns to 21:347/350 of 2vavB
>CCNA_00559 FitnessBrowser__Caulo:CCNA_00559
MAALDPITPAGGGTWRFPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTG
DQHVASPHPTTGKPGWWQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTY
GLSFPVITIADMVRAQAMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLAS
ASRHSAQNIAFHEVGRQAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQR
KFGRELQRDGLSWGFDADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGV
LAKAFTRARNVRFCVLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLD
EPVMDAALEGFLASAERDRGLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory