SitesBLAST
Comparing CCNA_00618 FitnessBrowser__Caulo:CCNA_00618 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
52% identity, 99% coverage: 8:472/472 of query aligns to 22:484/488 of 5u0mA
- active site: N148 (= N134), K171 (= K157), E246 (= E232), C280 (= C266), E377 (= E363), P455 (= P441)
- binding nicotinamide-adenine-dinucleotide: F144 (≠ I130), Y147 (≠ F133), N148 (= N134), K171 (= K157), S173 (= S159), E174 (= E160), G207 (= G193), T222 (= T208), G223 (= G209), S224 (≠ G210), V227 (≠ A213), E246 (= E232), M247 (≠ L233), G248 (= G234), C280 (= C266), E377 (= E363), F379 (= F365)
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
52% identity, 99% coverage: 8:472/472 of query aligns to 22:484/488 of 5u0lA
- active site: N148 (= N134), K171 (= K157), E246 (= E232), C280 (= C266), E377 (= E363), P455 (= P441)
- binding decanal: K107 (= K93), H152 (= H138), L153 (= L139), G156 (= G142), H157 (= H143), S456 (= S442), A457 (= A443)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
56% identity, 95% coverage: 24:472/472 of query aligns to 37:484/486 of 3ju8A
- active site: N147 (= N134), K170 (= K157), E245 (= E232), C279 (= C266), E377 (= E363), P455 (= P441)
- binding nicotinamide-adenine-dinucleotide: G144 (= G131), Y146 (≠ F133), N147 (= N134), L152 (= L139), K170 (= K157), S172 (= S159), F220 (= F207), T221 (= T208), G222 (= G209), S223 (≠ G210), T226 (≠ A213), E245 (= E232), M246 (≠ L233), G247 (= G234), C279 (= C266), E377 (= E363), F379 (= F365), F444 (= F430)
4pz2B Structure of zm aldh2-6 (rf2f) in complex with NAD (see paper)
34% identity, 95% coverage: 1:448/472 of query aligns to 23:476/494 of 4pz2B
- active site: N159 (= N134), K182 (= K157), E258 (= E232), C292 (= C266), E392 (= E363), D469 (≠ P441)
- binding nicotinamide-adenine-dinucleotide: I155 (= I130), I156 (≠ G131), P157 (= P132), W158 (≠ F133), N159 (= N134), M164 (≠ L139), K182 (= K157), A184 (≠ S159), E185 (= E160), G215 (= G190), G219 (= G193), F233 (= F207), T234 (= T208), G235 (= G209), S236 (≠ G210), V239 (≠ A213), E258 (= E232), L259 (= L233), C292 (= C266), E392 (= E363), F394 (= F365)
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 95% coverage: 2:448/472 of query aligns to 33:483/501 of Q56YU0
- G152 (≠ A117) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A380) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
4pxlA Structure of zm aldh2-3 (rf2c) in complex with NAD (see paper)
32% identity, 93% coverage: 1:437/472 of query aligns to 18:457/486 of 4pxlA
- active site: N154 (= N134), K177 (= K157), E253 (= E232), C287 (= C266), E384 (= E363)
- binding nicotinamide-adenine-dinucleotide: I150 (= I130), V151 (≠ G131), P152 (= P132), W153 (≠ F133), K177 (= K157), E180 (= E160), G210 (= G190), G214 (= G193), A215 (≠ E194), F228 (= F207), G230 (= G209), S231 (≠ G210), V234 (≠ A213), E253 (= E232), G255 (= G234), C287 (= C266), Q334 (≠ A315), K337 (≠ Q318), E384 (= E363), F386 (= F365)
Sites not aligning to the query:
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
34% identity, 92% coverage: 10:442/472 of query aligns to 27:463/489 of 6wsbA
- active site: N152 (= N134), E250 (= E232), C284 (= C266), E462 (≠ P441)
- binding nicotinamide-adenine-dinucleotide: I148 (= I130), G149 (= G131), A150 (≠ P132), W151 (≠ F133), N152 (= N134), K175 (= K157), E178 (= E160), G208 (= G190), G211 (= G193), A212 (≠ E194), F225 (= F207), T226 (= T208), G227 (= G209), G228 (= G210), T231 (≠ A213), V235 (≠ I217), E250 (= E232), L251 (= L233), G252 (= G234), C284 (= C266), E385 (= E363), F387 (= F365)
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
33% identity, 93% coverage: 10:450/472 of query aligns to 25:470/489 of 4o6rA
- active site: N150 (= N134), K173 (= K157), E248 (= E232), C282 (= C266), E383 (= E363), E460 (≠ P441)
- binding adenosine monophosphate: I146 (= I130), V147 (≠ G131), K173 (= K157), G206 (= G190), G210 (= G193), Q211 (≠ E194), F224 (= F207), G226 (= G209), S227 (≠ G210), T230 (≠ A213), R233 (≠ A216)
Q8NMB0 Vanillin dehydrogenase; Aromatic aldehyde dehydrogenase; EC 1.2.1.67; EC 1.2.1.64; EC 1.2.1.96 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
34% identity, 93% coverage: 10:448/472 of query aligns to 32:471/484 of Q8NMB0
- N157 (= N134) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). Less than 10% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 4.5-fold decreased affinity for NAD(+), 11-fold decreased affinity for NADP(+) and 2.3-fold decreased affinity for vanillin compared to the wild type.
- K180 (= K157) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). Less than 10% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 4.5-fold decreased affinity for NAD(+), 11-fold decreased affinity for NADP(+) and 5-fold decreased affinity for vanillin compared to the wild type.
- E199 (≠ A175) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). 78% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 5-fold decreased affinity for NAD(+), 2.5-fold decreased affinity for NADP(+) and 1.5-fold decreased affinity for vanillin compared to the wild type.
- E258 (= E232) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). 24% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 3.5-fold decreased affinity for NAD(+), 5-fold decreased affinity for NADP(+) and 3.7-fold decreased affinity for vanillin compared to the wild type.
- C292 (= C266) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). Less than 10% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 4.5-fold decreased affinity for NAD(+), 7-fold decreased affinity for NADP(+) and 8-fold decreased affinity for vanillin compared to the wild type.
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
34% identity, 93% coverage: 10:446/472 of query aligns to 22:461/476 of 4yweA
Sites not aligning to the query:
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
31% identity, 92% coverage: 10:442/472 of query aligns to 27:464/489 of 4cazA
- active site: N152 (= N134), K175 (= K157), E251 (= E232), C285 (= C266), E386 (= E363), E463 (≠ P441)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I130), G149 (= G131), W151 (≠ F133), N152 (= N134), K175 (= K157), E178 (= E160), G208 (= G190), G212 (= G193), F226 (= F207), T227 (= T208), G228 (= G209), G229 (= G210), T232 (≠ A213), V236 (≠ I217), E251 (= E232), L252 (= L233), C285 (= C266), E386 (= E363), F388 (= F365)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
31% identity, 92% coverage: 10:442/472 of query aligns to 27:464/489 of 2woxA
- active site: N152 (= N134), K175 (= K157), E251 (= E232), C285 (= C266), E386 (= E363), E463 (≠ P441)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I130), G149 (= G131), W151 (≠ F133), N152 (= N134), K175 (= K157), S177 (= S159), E178 (= E160), G208 (= G190), G212 (= G193), F226 (= F207), T227 (= T208), G228 (= G209), G229 (= G210), T232 (≠ A213), V236 (≠ I217), E251 (= E232), L252 (= L233), C285 (= C266), E386 (= E363), F388 (= F365)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
31% identity, 92% coverage: 10:442/472 of query aligns to 27:464/489 of 2wmeA
- active site: N152 (= N134), K175 (= K157), E251 (= E232), C285 (= C266), E386 (= E363), E463 (≠ P441)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G131), W151 (≠ F133), K175 (= K157), S177 (= S159), E178 (= E160), G208 (= G190), G212 (= G193), F226 (= F207), G228 (= G209), G229 (= G210), T232 (≠ A213), V236 (≠ I217)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
31% identity, 92% coverage: 10:442/472 of query aligns to 28:465/490 of Q9HTJ1
- GAWN 150:153 (≠ GPFN 131:134) binding
- K162 (≠ H143) active site, Charge relay system
- KPSE 176:179 (= KPSE 157:160) binding
- G209 (= G190) binding
- GTST 230:233 (≠ GVQA 210:213) binding
- E252 (= E232) active site, Proton acceptor
- C286 (= C266) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E363) binding
- E464 (≠ P441) active site, Charge relay system
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
30% identity, 98% coverage: 10:472/472 of query aligns to 35:492/497 of 8skfA
- binding calcium ion: D100 (≠ E75), V187 (≠ K161)
- binding nicotinamide-adenine-dinucleotide: I156 (= I130), G157 (= G131), A158 (≠ P132), W159 (≠ F133), K183 (= K157), E186 (= E160), G216 (= G189), G220 (= G193), T235 (= T208), G236 (= G209), G237 (= G210), S240 (≠ A213), K243 (≠ A216), E259 (= E232), C293 (= C266), F396 (= F365)
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
30% identity, 98% coverage: 10:472/472 of query aligns to 26:483/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
30% identity, 98% coverage: 10:472/472 of query aligns to 26:483/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
30% identity, 98% coverage: 10:472/472 of query aligns to 26:483/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
30% identity, 98% coverage: 10:472/472 of query aligns to 26:483/488 of 8vqwC
- binding coenzyme a: I147 (= I130), W150 (≠ F133), K174 (= K157), S176 (= S159), E177 (= E160), G207 (= G189), G211 (= G193), F225 (= F207), G227 (= G209), G228 (= G210), S231 (≠ A213), H331 (≠ A315), F387 (= F365)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
30% identity, 98% coverage: 10:472/472 of query aligns to 26:483/488 of 8vj3A
Query Sequence
>CCNA_00618 FitnessBrowser__Caulo:CCNA_00618
MSASRLISRDPYTGEAIADFAVNDARSIDAACHSARAAFAEWAMTPLAERRAIALRFAET
VRARREEIATLIARETGKPMWEALTEADSVAAKVAISIRAQDERAGERSEPMADATARLA
HRPHGVLAVIGPFNFPMHLANGHIVPALLAGNAVVFKPSEKTPACGQLMGELWRAAGLPD
HVLTIVIGGGEAGEALVRHEALDGVLFTGGVQAGRAIHRALADAPHKILALELGGNAPLV
VWDVADIEAAAHLIVQSAYVTAGQRCTCARRLILPEGARGDALLEALTMLMDRLVIGGPF
QSPAPFMGPVIDAHAAAQVLAAQDRMTADGGRPLRLAAVREARSALLSPGLIELTDAPLR
DEEIFGPLLQVRRAADFDAALALANATRFGLAAGLISDDEALYRRFWTSVRAGIVNWNRP
TTGASSAAPFGGVGGSGNHRPSAYYAADYSAYPVAGLESPSPVYRLPIGLNP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory