SitesBLAST
Comparing CCNA_00651 FitnessBrowser__Caulo:CCNA_00651 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
37% identity, 31% coverage: 36:287/822 of query aligns to 31:283/409 of 3lxdA
- active site: R44 (= R49), P45 (≠ I50)
- binding flavin-adenine dinucleotide: R36 (≠ A41), E37 (= E42), R44 (= R49), P45 (≠ I50), S48 (= S53), K49 (≠ P54), E81 (≠ A85), V82 (= V86), T109 (= T113), I157 (≠ L161), G278 (= G282), D279 (≠ E283)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
32% identity, 33% coverage: 67:336/822 of query aligns to 66:346/541 of 6pfzA
- binding calcium ion: D306 (≠ E300), T332 (≠ S322)
- binding coenzyme a: K76 (≠ N76), R313 (= R303)
- binding flavin-adenine dinucleotide: A86 (≠ V86), A115 (= A112), T116 (= T113), G117 (= G114), L136 (≠ F133), G286 (= G282), D287 (≠ E283), P303 (= P297), F304 (≠ I298), G305 (≠ W299)
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
31% identity, 45% coverage: 8:375/822 of query aligns to 1:343/359 of Q8U1K9
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
27% identity, 45% coverage: 9:379/822 of query aligns to 4:352/378 of 3kljA
- active site: P12 (≠ M17), R41 (= R49), P42 (≠ I50), N274 (≠ W299)
- binding flavin-adenine dinucleotide: L8 (≠ I13), G9 (= G14), G11 (= G16), P12 (≠ M17), A13 (= A18), N32 (≠ G40), S33 (≠ A41), E34 (= E42), R41 (= R49), P42 (≠ I50), F77 (≠ A85), A78 (≠ V86), S105 (≠ T113), G106 (= G114), L123 (≠ F133), Y124 (≠ R134), L150 (= L161), G257 (= G282), D258 (≠ E283), G268 (= G293), L269 (= L294), I270 (≠ V295), A273 (≠ I298), K301 (= K326)
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
27% identity, 45% coverage: 9:379/822 of query aligns to 5:353/379 of Q9AL95
- C26 (≠ D30) modified: Disulfide link with 286
- NSE 33:35 (≠ GAE 40:42) binding
- R42 (= R49) binding
- A79 (≠ V86) binding
- Y125 (≠ R134) binding
- C137 (≠ A147) modified: Disulfide link with 216
- C216 (≠ L240) modified: Disulfide link with 137
- D259 (≠ E283) binding
- C286 (≠ T310) modified: Disulfide link with 26
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 38% coverage: 1:309/822 of query aligns to 1:303/384 of Q9HTK9
Sites not aligning to the query:
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
34% identity, 36% coverage: 10:309/822 of query aligns to 4:300/381 of 2v3aA
- active site: L11 (≠ M17), K42 (≠ R49), P43 (≠ I50), M290 (≠ W299)
- binding flavin-adenine dinucleotide: I7 (= I13), G8 (= G14), T9 (≠ N15), G10 (= G16), A12 (= A18), T33 (≠ F39), A34 (≠ G40), D35 (≠ A41), K42 (≠ R49), P43 (≠ I50), R79 (= R84), V80 (= V86), A105 (= A112), W106 (≠ T113), G107 (= G114), I153 (≠ L161), F157 (≠ A165), D274 (≠ E283), L284 (≠ G293), Y285 (≠ L294), V286 (= V295)
Sites not aligning to the query:
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
31% identity, 45% coverage: 8:374/822 of query aligns to 1:376/424 of 8c0zE
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
29% identity, 40% coverage: 9:336/822 of query aligns to 2:338/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (= I13), G7 (= G14), V9 (≠ M17), G11 (= G19), E32 (≠ G40), K33 (≠ A41), C42 (≠ I50), V80 (= V86), S109 (≠ A112), P110 (≠ T113), G111 (= G114), I159 (≠ L161), G278 (= G282), D279 (≠ E283), S295 (≠ G293), L296 (= L294), A297 (≠ V295)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ E25), R18 (≠ V26), R21 (= R29), F70 (≠ N76), R305 (= R303)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
33% identity, 38% coverage: 29:339/822 of query aligns to 23:335/443 of 6rvhA
- active site: V39 (= V45), C44 (≠ I50), E53 (= E59), E58 (= E63), Y159 (≠ L160), E163 (= E164)
- binding coenzyme a: R23 (= R29), S40 (≠ N46), Y41 (= Y47), C44 (≠ I50), R63 (≠ N68), N303 (≠ D311), R307 (≠ A315)
- binding flavin-adenine dinucleotide: E34 (≠ G40), K35 (≠ A41), A43 (≠ R49), C44 (≠ I50), V81 (= V86), T113 (= T113), G114 (= G114), R134 (= R134), Y159 (≠ L160), G280 (= G282), D281 (≠ E283), P297 (≠ M301), L298 (≠ C302), G299 (≠ R303)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 20, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
33% identity, 38% coverage: 29:339/822 of query aligns to 23:335/443 of 6rvbA
- active site: V39 (= V45), C44 (≠ I50), E53 (= E59), E58 (= E63), Y159 (≠ L160), E163 (= E164)
- binding coenzyme a: R23 (= R29), S40 (≠ N46), Y41 (= Y47), C44 (≠ I50), R63 (≠ N68), N303 (≠ D311), R307 (≠ A315)
- binding flavin-adenine dinucleotide: Y33 (≠ F39), E34 (≠ G40), K35 (≠ A41), S36 (≠ E42), A43 (≠ R49), C44 (≠ I50), E80 (≠ A85), V81 (= V86), T113 (= T113), G114 (= G114), L133 (≠ F133), R134 (= R134), I160 (≠ L161), G280 (= G282), D281 (≠ E283), L298 (≠ C302), G299 (≠ R303)
- binding nicotinamide-adenine-dinucleotide: G156 (= G157), G158 (= G159), Y159 (≠ L160), I160 (≠ L161), E179 (≠ H180), A180 (≠ L181), A240 (= A244), T241 (≠ V245), G242 (= G246), P297 (≠ M301), I328 (≠ V332), F329 (= F333)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 20, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
33% identity, 38% coverage: 29:339/822 of query aligns to 23:335/443 of 6ruzA
- active site: V39 (= V45), C44 (≠ I50), E53 (= E59), E58 (= E63), Y159 (≠ L160), E163 (= E164)
- binding coenzyme a: R23 (= R29), S40 (≠ N46), Y41 (= Y47), C44 (≠ I50), R63 (≠ N68), N303 (≠ D311), R307 (≠ A315)
- binding flavin-adenine dinucleotide: Y33 (≠ F39), E34 (≠ G40), K35 (≠ A41), A43 (≠ R49), C44 (≠ I50), E80 (≠ A85), V81 (= V86), T113 (= T113), G114 (= G114), A115 (≠ S115), L133 (≠ F133), R134 (= R134), Y159 (≠ L160), G280 (= G282), D281 (≠ E283), P297 (≠ M301), L298 (≠ C302), G299 (≠ R303)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 19, 20, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 33% coverage: 10:284/822 of query aligns to 4:275/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G16), V11 (≠ M17), G12 (≠ A18), D34 (≠ A41), E35 (= E42), R42 (= R49), P43 (≠ I50), K47 (≠ P54), E78 (≠ A85), V79 (= V86), T106 (= T113), G107 (= G114), G273 (= G282), D274 (≠ E283)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ F118), G149 (= G157), L152 (= L160), I153 (≠ L161), E156 (= E164), E172 (≠ H180), A173 (≠ L181), R180 (= R188), V236 (= V245), G237 (= G246), A238 (≠ I247)
Sites not aligning to the query:
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 33% coverage: 10:284/822 of query aligns to 5:276/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G16), V12 (≠ M17), G13 (≠ A18), D35 (≠ A41), E36 (= E42), R43 (= R49), P44 (≠ I50), S47 (= S53), K48 (≠ P54), V80 (= V86), T107 (= T113), G108 (= G114), R128 (= R134), G274 (= G282), D275 (≠ E283)
Sites not aligning to the query:
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
31% identity, 41% coverage: 9:346/822 of query aligns to 2:324/346 of 1xhcA
- active site: P10 (≠ M17), K38 (≠ R49), P39 (≠ I50), F145 (≠ L160), E149 (= E164), M276 (≠ W299)
- binding flavin-adenine dinucleotide: V6 (≠ I13), G7 (= G14), G9 (= G16), P10 (≠ M17), G11 (≠ A18), D29 (≠ G40), K30 (≠ A41), K38 (≠ R49), P39 (≠ I50), E74 (≠ A85), A75 (≠ V86), A100 (= A112), T101 (= T113), G102 (= G114), L119 (≠ F133), R120 (= R134), F145 (≠ L160), I146 (≠ L161), E149 (= E164), G259 (= G282), D260 (≠ E283), G270 (= G293), T271 (≠ L294), A272 (≠ V295)
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
32% identity, 31% coverage: 56:308/822 of query aligns to 52:308/422 of 1q1wA
Sites not aligning to the query:
- active site: 13, 44, 45
- binding flavin-adenine dinucleotide: 10, 12, 13, 14, 35, 36, 44, 45, 49, 329
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
32% identity, 31% coverage: 56:308/822 of query aligns to 53:309/422 of P16640
- V83 (= V86) binding
- R134 (≠ V131) binding
- D284 (≠ E283) binding
- V302 (≠ M301) binding
Sites not aligning to the query:
- 15 binding
- 37 binding
- 50 binding
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 31% coverage: 38:293/822 of query aligns to 35:306/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
32% identity, 36% coverage: 10:308/822 of query aligns to 4:300/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), H11 (≠ M17), A12 (= A18), D34 (≠ A41), E35 (= E42), R42 (= R49), P43 (≠ I50), S46 (= S53), K47 (≠ P54), R78 (= R84), M79 (≠ A85), T106 (= T113), R127 (= R134), I153 (≠ L161), D275 (≠ E283), S292 (≠ E300), V293 (≠ M301)
Sites not aligning to the query:
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
31% identity, 33% coverage: 70:337/822 of query aligns to 65:363/565 of 3nt6A
- active site: N325 (≠ W299)
- binding coenzyme a: A321 (≠ V295), N325 (≠ W299), R329 (= R303)
- binding flavin-adenine dinucleotide: E80 (≠ A85), V81 (= V86), S112 (≠ A112), P113 (≠ T113), G114 (= G114), L133 (≠ F133), R134 (= R134), F161 (≠ L160), G302 (= G282), D303 (≠ E283), P319 (vs. gap), L320 (= L294), A321 (≠ V295)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43
Query Sequence
>CCNA_00651 FitnessBrowser__Caulo:CCNA_00651
MTQATPKLRLVVIGNGMAGCRAVEEVLKRDPDRYAVTIFGAEPRVNYNRIMLSPVLAGEK
AFEDIVINDEAWYRDNGITLHAGRAVTAIDLAARKVFAEGGLEIGYDKLILATGSDPFRL
PLPGGDLKGVVTFRDLDDVNAMLAASAEPDARAVVIGGGLLGLEAAYGLARRGMAATVVH
LMDVLMERQLDESAGYLLREALADRGVETVLGAHSEEIVGADGQVTGLKLKDGRVLPCDL
LVMAVGIRPNTTLAKAAGLTVNRGVAVDDAMRTSDPDVFAVGECVEHRGQCYGLVAPIWE
MCRALAQALTDGEGAYQGSVLSTRLKVSGVDVFSAGKFAGGEGCEDIVFRDAARGVYKRV
VIEDGKVAGAVLFGDAADGGWYFDLMKAGADVAGIRETLIFGQAITEGLSGLDPSAAVAA
MPDTQEICGCNGVCKGAITSAITAQGLTTLDDVRAVTKASASCGSCTPLVEQVLKLTLGD
GFQAQTGPKPICKCSPKTHGDVRRAIVDQGLKSMPAVMQALEWSTPDGCASCRPALNYYL
LCAWPGEYRDDKQSRYINERVHANIQKDGTYSVVPRMWGGMTSPAELRAIADVAEKFAIP
AVKVTGGQRIDLLGVKKDDLPAVWADLNAAGMVSGHAYAKGLRTVKTCVGSDWCRFGTQD
STGLGMRLEKFLWGSWAPAKVKLAVSGCPRNCAEATCKDFGVVCVDSGYEIHIGGAAGLH
IQGTQVLTRVATEDEAVWVIAAAMQLYREEGWYLERVYKWMDRVGLESIRAQVTDPDQRR
ALYDRFVYSQRFARIDPWAERVAGRHNEEFTPMSRRMEFVPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory