SitesBLAST
Comparing CCNA_00664 FitnessBrowser__Caulo:CCNA_00664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 95% coverage: 7:403/417 of query aligns to 15:421/425 of O59010
- S65 (≠ T51) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S263) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 263:265) binding
- M311 (≠ L298) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T301) binding
- V355 (= V342) binding
- D394 (≠ S376) binding
- M395 (≠ E377) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R379) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N383) binding
- D405 (≠ N387) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 94% coverage: 7:398/417 of query aligns to 6:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 95% coverage: 7:401/417 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L32), F46 (≠ L32), P75 (≠ D61), L91 (≠ V78), F95 (≠ L82), L130 (≠ M125), I133 (≠ Y128), I159 (= I154), Y167 (≠ R162), K196 (≠ G183), G200 (≠ I187), I207 (= I194), F210 (= F197), L250 (≠ I237), I262 (≠ L249), M269 (≠ L256), T334 (≠ S321), V335 (≠ L322), G336 (= G323), T340 (≠ A327), L343 (≠ G330), M399 (≠ L381)
- binding aspartic acid: S277 (= S264), S278 (= S265), T314 (= T301), G354 (= G341), A358 (= A345), G359 (= G346), D394 (≠ S376), R397 (= R379), T398 (≠ A380)
- binding sodium ion: Y89 (≠ F76), T92 (≠ V79), S93 (= S80), G306 (= G293), T308 (≠ S295), N310 (= N297), N310 (= N297), M311 (≠ L298), D312 (= D299), S349 (= S336), I350 (≠ K337), T352 (≠ A339), N401 (= N383), V402 (≠ L384), D405 (≠ N387)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 94% coverage: 7:399/417 of query aligns to 7:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 94% coverage: 7:398/417 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G55), V83 (≠ L73), I157 (≠ L155), Y164 (≠ R162), K193 (≠ G183), T305 (≠ S295), I306 (≠ F296), I347 (≠ K337)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V8), M199 (≠ V189), S275 (= S265), T311 (= T301), G356 (= G346), L384 (≠ V369), D391 (≠ S376), R394 (= R379)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 94% coverage: 7:398/417 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S265), M303 (≠ L298), T306 (= T301), A345 (≠ S340), G346 (= G341), V347 (= V342), G351 (= G346), D386 (≠ S376), C389 (≠ R379), T390 (≠ A380), N393 (= N383)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
30% identity, 96% coverage: 7:405/417 of query aligns to 11:421/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
30% identity, 96% coverage: 7:405/417 of query aligns to 13:423/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
30% identity, 96% coverage: 7:405/417 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G183), G195 (≠ I187), R282 (≠ E274)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S263), S272 (= S264), S273 (= S265), M307 (≠ L298), T310 (= T301), G353 (= G344), A354 (= A345), R394 (= R379), T395 (≠ A380)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
30% identity, 96% coverage: 7:405/417 of query aligns to 13:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S263), S275 (= S264), S276 (= S265), T313 (= T301), G353 (= G341), V354 (= V342), A357 (= A345), G358 (= G346), D394 (≠ S376), R397 (= R379), T398 (≠ A380)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G183), G198 (≠ I187), Y202 (≠ L191)
- binding sodium ion: Y87 (≠ F76), T90 (≠ V79), S91 (= S80), S276 (= S265), G305 (= G293), A306 (≠ Y294), T307 (≠ S295), N309 (= N297), N309 (= N297), M310 (≠ L298), D311 (= D299), S348 (= S336), I349 (≠ K337), G350 (= G338), T351 (≠ A339), N401 (= N383), V402 (≠ L384), D405 (≠ N387)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 96% coverage: 7:405/417 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S263), S265 (= S265), M299 (≠ L298), T302 (= T301), T340 (≠ A339), G342 (= G341), V343 (= V342), G347 (= G346), D383 (≠ S376), R386 (= R379), T387 (≠ A380), N390 (= N383)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Q24), V212 (≠ L212), A216 (≠ G216)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 94% coverage: 7:398/417 of query aligns to 7:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 90% coverage: 33:408/417 of query aligns to 57:408/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ F65), G89 (= G66), G92 (= G69), A95 (= A72), V96 (≠ L73), Y99 (≠ F76), M163 (≠ I154), F167 (= F158), F293 (≠ L288), V297 (≠ T292)
- binding aspartic acid: S268 (= S264), S269 (= S265), T306 (= T301), G346 (= G341), I347 (≠ V342), A350 (= A345), G351 (= G346), D380 (≠ S376), R383 (= R379), T384 (≠ A380)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 90% coverage: 33:408/417 of query aligns to 49:394/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I56), S80 (≠ F65), G81 (= G66), G84 (= G69), Y91 (≠ F76), M156 (≠ I154), F160 (= F158), F286 (≠ L288), V290 (≠ T292)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I48), I148 (≠ L146), S262 (= S265), S263 (≠ E266), A292 (≠ Y294), T293 (≠ S295), M296 (≠ L298), T299 (= T301), G329 (= G338), A336 (= A345), G337 (= G346), D366 (≠ S376), R369 (= R379), N373 (= N383)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 94% coverage: 17:409/417 of query aligns to 31:421/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S264), S281 (= S265), T318 (= T301), G363 (= G346), M367 (≠ L350), V385 (= V369), D388 (= D372), R395 (= R379), T396 (≠ A380)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R373)
- binding cholesterol hemisuccinate: R80 (= R67), R84 (≠ K71), I95 (≠ L82), I252 (= I237)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 94% coverage: 17:409/417 of query aligns to 30:422/425 of 7xr4A
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
26% identity, 84% coverage: 61:409/417 of query aligns to 70:412/416 of 8cuaA
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 95% coverage: 13:408/417 of query aligns to 55:504/542 of P43003
- S363 (= S263) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (= SSS 263:265) binding
- T396 (≠ S295) binding
- T402 (= T301) binding
- IPQAG 443:447 (≠ VTGAG 342:346) binding
- D476 (≠ S376) binding
- R477 (≠ E377) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N383) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
24% identity, 95% coverage: 13:408/417 of query aligns to 55:504/543 of P56564
- N206 (≠ G122) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ L132) modified: carbohydrate, N-linked (GlcNAc...) asparagine
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
26% identity, 81% coverage: 61:396/417 of query aligns to 67:400/406 of 8ctcA
- binding glutamic acid: S268 (= S264), S269 (= S265), M303 (≠ L298), T306 (= T301), G346 (= G341), A350 (= A345), D380 (≠ S376), R383 (= R379)
- binding sodium ion: Y82 (≠ F76), T85 (≠ V79), T86 (≠ S80), S269 (= S265), G298 (= G293), A299 (≠ Y294), T300 (≠ S295), N302 (= N297), N302 (= N297), M303 (≠ L298), D304 (= D299), S341 (= S336), I342 (≠ K337), G343 (= G338), A344 (= A339), N387 (= N383), D391 (≠ N387)
Query Sequence
>CCNA_00664 FitnessBrowser__Caulo:CCNA_00664
MKSIYVQVLIAIVLGVLVGAIWPQIGVALKPLGDGFIKLIKLVIAPVIFCTVAGGIARMG
DMKAFGRVGVKALIYFEVVSTLALVIGLVVGRLIQPGAGFNIDPATLDASIAAGYVEKAQ
HGEGMVAYLLHLIPDTFIGAFADGNLLQVLVIAILTGFACVRMGDFGEKVAHVLDETSKL
FFGIIHIVVRLAPIGAFGAMGFTIGKYGVEALVQLGALVATFYVTSLLFVLVVLGGIAWV
SGFSIFRFLAYIREELLIVLGTSSSESVLPQMMEKLENAGARRSVVGLVIPTGYSFNLDG
TNIYMTLATLFLAQATNTPLSLGQELALLGVAMLTSKGASGVTGAGFITLAATLAVVPDI
PIAALAILVGVDRFMSECRALTNLVGNGVATLVVARWEGALDRQRLDRVLRGAPATE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory