SitesBLAST
Comparing CCNA_00857 FitnessBrowser__Caulo:CCNA_00857 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
38% identity, 96% coverage: 19:477/478 of query aligns to 4:475/491 of P0AGF4
- F24 (= F39) mutation to A: Decreases xylose transport.
- G83 (= G90) mutation to A: Abolishes xylose transport.
- R133 (= R122) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E142) mutation to A: Abolishes xylose transport.
- R160 (= R149) mutation to A: Abolishes xylose transport.
- Q168 (= Q157) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q286) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 286:287) binding
- Q289 (= Q287) mutation to A: Strongly decreases xylose transport.
- N294 (= N292) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y296) mutation to A: Abolishes xylose transport.
- N325 (≠ S323) mutation to A: No effect on xylose transport.
- G340 (= G338) mutation to A: Abolishes xylose transport.
- R341 (= R339) mutation R->A,W: Abolishes xylose transport.
- W392 (= W401) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E406) mutation to A: Abolishes xylose transport.
- R404 (= R413) mutation to A: Strongly decreases xylose transport.
- Q415 (= Q424) binding
- W416 (= W425) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
38% identity, 96% coverage: 21:477/478 of query aligns to 2:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
38% identity, 96% coverage: 21:477/478 of query aligns to 2:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
38% identity, 96% coverage: 21:477/478 of query aligns to 2:471/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
32% identity, 91% coverage: 41:477/478 of query aligns to 21:434/446 of A0A0H2VG78
- D22 (= D42) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R122) mutation to A: Loss of transport activity.
- I105 (≠ G125) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E142) mutation to A: Loss of transport activity.
- Q137 (= Q157) mutation to A: Loss of transport activity.
- Q250 (= Q286) mutation to A: Loss of transport activity.
- Q251 (= Q287) mutation to A: Loss of transport activity.
- N256 (= N292) mutation to A: Loss of transport activity.
- W357 (= W401) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 97% coverage: 9:470/478 of query aligns to 19:469/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 90% coverage: 19:449/478 of query aligns to 80:517/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
31% identity, 95% coverage: 19:474/478 of query aligns to 5:459/493 of P32037
- N43 (= N58) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
29% identity, 93% coverage: 29:474/478 of query aligns to 14:459/496 of P11169
- Q159 (= Q157) binding
- QLS 277:279 (≠ AVF 283:285) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (= QQ 286:287) binding
- N286 (= N292) binding
- N315 (≠ S323) binding
- E378 (≠ N393) binding
- W386 (= W401) binding
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 73% coverage: 24:372/478 of query aligns to 27:373/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
5c65A Structure of the human glucose transporter glut3 / slc2a3
30% identity, 93% coverage: 29:474/478 of query aligns to 10:447/457 of 5c65A
- binding Octyl Glucose Neopentyl Glycol : L42 (≠ K61), L58 (vs. gap), F75 (= F80), S76 (≠ A81), L79 (≠ R84), R87 (= R92), L95 (= L100), L96 (= L101), L121 (= L123), P199 (≠ L211)
- binding cholesterol hemisuccinate: I270 (≠ L280), S396 (≠ A423), T399 (≠ I426)
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
29% identity, 93% coverage: 29:474/478 of query aligns to 14:459/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (= Q157), I166 (≠ L164), Q280 (= Q286), Q281 (= Q287), N286 (= N292), F377 (= F392), W386 (= W401)
- binding alpha-D-glucopyranose: Q159 (= Q157), I162 (= I160), I166 (≠ L164), Q280 (= Q286), Q281 (= Q287), N286 (= N292), W386 (= W401)
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
29% identity, 93% coverage: 29:474/478 of query aligns to 11:456/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F39), T25 (≠ S43), N29 (= N47), Q156 (= Q157), I163 (≠ L164), Q278 (= Q287), F286 (= F295), A308 (≠ S319), N312 (≠ S323), F374 (= F392), E375 (≠ N393), N406 (≠ Q424), W407 (= W425), N410 (= N428)
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
29% identity, 93% coverage: 29:474/478 of query aligns to 12:457/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (≠ S43), A66 (≠ G69), S69 (≠ L72), Q157 (= Q157), I164 (≠ L164), Q278 (= Q286), Q279 (= Q287), N284 (= N292), N313 (≠ S323), F375 (= F392), W384 (= W401), N411 (= N428), F412 (= F429), G415 (≠ S432)
P39004 High-affinity hexose transporter HXT7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 93% coverage: 35:477/478 of query aligns to 75:525/570 of P39004
Sites not aligning to the query:
- 560 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P39003 High-affinity hexose transporter HXT6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 93% coverage: 35:477/478 of query aligns to 75:525/570 of P39003
Sites not aligning to the query:
- 560 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
29% identity, 93% coverage: 29:474/478 of query aligns to 14:459/470 of 7sptA
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 71% coverage: 24:364/478 of query aligns to 26:367/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
27% identity, 93% coverage: 32:476/478 of query aligns to 19:463/492 of P11166
- N34 (= N47) to S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- N45 (= N58) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to T: Loss of glycosylation site.
- R51 (≠ K61) to H: in EIG12; uncertain significance; dbSNP:rs201815571
- T60 (vs. gap) to M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- M77 (≠ A76) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G90) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R122) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G126) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ S133) binding
- P149 (= P145) to A: in EIG12; uncertain significance
- R153 (= R149) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (≠ T165) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (≠ M198) mutation to C: Strongly decreases glucose transport.
- L204 (= L210) mutation to C: Abolishes glucose transport.
- P205 (≠ L211) mutation to C: Abolishes glucose transport.
- R212 (= R218) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (≠ K223) to S: in EIG12; decreased glucose transport
- R223 (≠ Q228) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ A231) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (≠ F237) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (= E248) to V: in EIG12; decreased glucose transport
- A275 (≠ G279) to T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- Q282 (= Q286) binding
- QQLS 282:285 (≠ QQLV 286:289) natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- G286 (= G290) to D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- T295 (≠ S299) to M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- V303 (≠ F307) to L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- G314 (= G320) to S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- S324 (≠ A330) to L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- E329 (≠ D335) to Q: in GLUT1DS1; stabilizes the inward-open conformation
- R333 (= R339) to Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; to W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- G340 (= G346) mutation to C: Strongly decreases glucose transport.
- W388 (= W401) binding
- N411 (≠ Q424) Not glycosylated; binding ; to S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- I435 (≠ G448) natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- R458 (≠ K471) to W: in EIG12; decreased glucose transport; dbSNP:rs13306758
Sites not aligning to the query:
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
P32467 Low-affinity glucose transporter HXT4; Low-affinity glucose transporter LGT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 87% coverage: 35:449/478 of query aligns to 81:502/576 of P32467
Sites not aligning to the query:
- 45 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Query Sequence
>CCNA_00857 FitnessBrowser__Caulo:CCNA_00857
MASVSNAGPSAGMSADGGKVNMTFVAAIVAVATIGGFMFGYDSGVINGTQEGLESAFNLS
KLGTGLNVGAILIGCAIGAFAAGRLADVWGRRTVMIISALLFVISAIGTGAAESSIVFII
FRLIGGLGVGAASVLCPVYISEVTPANIRGRLSSVQQIMIITGLTGAFVANYALAHTAGS
STAEFWLGLPAWRWMFWMQIIPAGVFFLCLLGIPESPRYLVAKGKDAQAEAILSRLFGAG
QGAKKVEEIRASLSADHKPTFSDLLDPTTKKLRVILWAGLVLAVFQQLVGINIVFYYGSV
LWQSVGFTEDDSLKINILSGTLSILACLLAIGLIDKIGRKPLLLIGSAGMAVTLGVLTWC
FSTATTVNGALTLGDQIGLTALIAANLYVIFFNLSWGPVMWVMLGEMFPNQMRGSALAVC
GFAQWIANFAISVSFPALAAASLPMTYGFYALSAVVSFFLVQKLVHETRGKELEAMQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory