SitesBLAST
Comparing CCNA_00864 FitnessBrowser__Caulo:CCNA_00864 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
53% identity, 98% coverage: 4:247/248 of query aligns to 4:253/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G18), T21 (≠ S21), I23 (= I23), D42 (= D42), I43 (= I43), C68 (= C67), D69 (= D68), L70 (= L69), N96 (= N91), A98 (≠ G93), F146 (= F141), S147 (≠ G142), S148 (= S143), Y161 (= Y156), K165 (= K160), P191 (= P186), G192 (= G187), W193 (≠ N188), V194 (= V189), R198 (= R193)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
48% identity, 98% coverage: 4:247/248 of query aligns to 9:257/258 of 5wjsA
- active site: G27 (= G22), S152 (= S143), Y162 (≠ L153), Y165 (= Y156), K169 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G18), T26 (≠ S21), I28 (= I23), D47 (= D42), L48 (≠ I43), D73 (= D68), L74 (= L69), N100 (= N91), A102 (≠ G93), L150 (≠ F141), G151 (= G142), S152 (= S143), K169 (= K160), P195 (= P186), G196 (= G187), W197 (≠ N188), V198 (= V189), K202 (≠ R193)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 96% coverage: 9:246/248 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), M16 (≠ I23), D35 (= D42), I36 (= I43), I62 (≠ L69), N88 (= N91), G90 (= G93), I138 (≠ F141), S140 (= S143), Y152 (= Y156), K156 (= K160), I185 (≠ V189)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 96% coverage: 9:246/248 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S21) binding
- D36 (= D42) binding
- D62 (= D68) binding
- I63 (≠ L69) binding
- N89 (= N91) binding
- Y153 (= Y156) binding
- K157 (= K160) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
33% identity, 96% coverage: 9:247/248 of query aligns to 3:245/248 of 4urfB
- active site: G16 (= G22), S142 (= S143), I152 (≠ L153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L212), R211 (≠ K213), R212 (≠ G214)
- binding bicarbonate ion: I92 (vs. gap), G94 (≠ D95), R109 (≠ E110), R179 (= R180), S228 (= S230)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), G14 (= G20), N15 (≠ S21), G16 (= G22), I17 (= I23), D36 (= D42), I37 (= I43), D62 (= D68), T63 (≠ L69), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ F141), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), I188 (≠ V189), T190 (= T191)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
33% identity, 96% coverage: 9:247/248 of query aligns to 3:245/248 of 4urfA
- active site: G16 (= G22), S142 (= S143), I152 (≠ L153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (vs. gap), S93 (≠ N94), G94 (≠ D95), E95 (≠ D96), T97 (≠ H98), E101 (≠ D102), T103 (= T104), Q106 (≠ Y107), R109 (≠ E110), S175 (≠ P176), G177 (≠ D178)
- binding magnesium ion: S237 (≠ H239), Y238 (≠ E240)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), G14 (= G20), N15 (≠ S21), G16 (= G22), I17 (= I23), D36 (= D42), I37 (= I43), W41 (≠ D47), D62 (= D68), T63 (≠ L69), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ F141), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (= T191)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
33% identity, 96% coverage: 9:247/248 of query aligns to 3:245/248 of 4ureB
- active site: G16 (= G22), S142 (= S143), I152 (≠ L153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S21), G16 (= G22), I17 (= I23), N89 (= N91), G91 (= G93), Y155 (= Y156), P185 (= P186), A186 (≠ G187)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 96% coverage: 9:246/248 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G22), N111 (= N115), S139 (= S143), Q149 (≠ L153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ R97), K98 (≠ D102), S139 (= S143), N146 (≠ L150), V147 (≠ E151), Q149 (≠ L153), Y152 (= Y156), F184 (≠ N188), M189 (≠ R193), K200 (≠ I206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ S21), G18 (= G22), I19 (= I23), D38 (= D45), F39 (≠ E46), V59 (≠ C67), D60 (= D68), V61 (≠ L69), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ N94), T137 (≠ F141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ N188), T185 (≠ V189), T187 (= T191), M189 (≠ R193)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 97% coverage: 8:247/248 of query aligns to 2:245/247 of 4jroC
- active site: G16 (= G22), S142 (= S143), Q152 (≠ L153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ G20), R15 (≠ S21), G16 (= G22), I17 (= I23), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (≠ L41), N63 (≠ D68), V64 (≠ L69), N90 (= N91), A91 (= A92), I93 (≠ N94), I113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (= T191)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
35% identity, 93% coverage: 9:239/248 of query aligns to 6:237/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G18), R18 (≠ S21), G19 (= G22), I20 (= I23), D39 (= D42), R40 (≠ A44), C63 (= C67), I65 (≠ L69), N91 (= N91), G93 (= G93), I94 (≠ N94), V114 (= V114), Y155 (= Y156), K159 (= K160), I188 (≠ V189), T190 (= T191), T193 (≠ Q194)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
32% identity, 98% coverage: 6:247/248 of query aligns to 2:251/254 of 4fn4A
- active site: G18 (= G22), S144 (= S143), Y157 (= Y156), K161 (= K160), S202 (≠ E201)
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), S17 (= S21), G18 (= G22), I19 (= I23), E38 (≠ D42), L39 (≠ I43), R43 (≠ D47), A63 (≠ C67), D64 (= D68), V65 (≠ L69), N91 (= N91), G93 (= G93), I94 (vs. gap), T142 (≠ F141), S144 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), V190 (= V189), T192 (= T191), N193 (≠ K192), I194 (≠ R193)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 97% coverage: 9:248/248 of query aligns to 5:256/258 of 3ak4A
- active site: G18 (= G22), S141 (= S143), L151 (= L153), Y154 (= Y156), K158 (= K160), E199 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S21), G18 (= G22), I19 (= I23), D38 (= D45), L39 (≠ E46), V60 (≠ C67), D61 (= D68), V62 (≠ L69), N88 (= N91), A89 (= A92), G90 (= G93), T139 (≠ F141), S141 (= S143), Y154 (= Y156), K158 (= K160), G185 (= G187), V187 (= V189), T189 (= T191), M191 (≠ R193)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
36% identity, 95% coverage: 12:246/248 of query aligns to 1:248/253 of 4nbwA
- active site: G12 (= G22), S146 (= S143), Y159 (= Y156), K163 (= K160)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), N11 (≠ S21), G12 (= G22), I13 (= I23), D32 (= D42), L33 (≠ I43), V57 (≠ C67), D58 (= D68), V59 (≠ L69), N85 (= N91), A86 (= A92), G87 (= G93), S146 (= S143), Y159 (= Y156), K163 (= K160), I192 (≠ V189), T194 (= T191)
7wbcA Hydroxysteroid dehydrogenase wild-type complexed with NAD+ and (4s)-2- 2-methyl-2,4-pentanediol
34% identity, 96% coverage: 9:246/248 of query aligns to 3:245/250 of 7wbcA
- binding calcium ion: Y115 (≠ R117), P116 (≠ H118), H119 (≠ F121)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), G16 (= G22), I17 (= I23), D36 (= D42), V37 (≠ I43), A61 (≠ C67), D62 (= D68), I63 (≠ L69), N89 (= N91), F138 (= F141), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), F184 (≠ N188), A185 (≠ V189), T187 (= T191), G189 (≠ R193), V190 (≠ Q194)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
36% identity, 96% coverage: 9:246/248 of query aligns to 4:243/247 of 3rwbA
- active site: G17 (= G22), S140 (= S143), Y153 (= Y156), K157 (= K160)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S143), N141 (≠ I144), T142 (≠ S145), M150 (≠ L153), Y153 (= Y156), L185 (≠ N188), H196 (≠ T199)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), Q16 (≠ S21), G17 (= G22), I18 (= I23), D37 (= D42), I38 (= I43), D60 (= D68), I61 (≠ L69), N87 (= N91), A88 (= A92), S89 (≠ G93), I138 (≠ F141), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), L185 (≠ N188), I186 (≠ V189), S188 (≠ T191), G190 (≠ R193), V191 (≠ Q194)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
36% identity, 96% coverage: 9:246/248 of query aligns to 4:243/247 of 3ndrA
- active site: G17 (= G22), S140 (= S143), Y153 (= Y156), K157 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), Q16 (≠ S21), G17 (= G22), I18 (= I23), D37 (= D42), I38 (= I43), D60 (= D68), I61 (≠ L69), N87 (= N91), A88 (= A92), S89 (≠ G93), V110 (= V114), I138 (≠ F141), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), L185 (≠ N188), I186 (≠ V189), S188 (≠ T191), G190 (≠ R193), V191 (≠ Q194)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 96% coverage: 9:246/248 of query aligns to 5:237/260 of P9WGT1
- I6 (≠ K10) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ SGI 21:23) binding
- D38 (= D42) binding
- V47 (≠ L51) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DL 68:69) binding
- T69 (≠ L72) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N91) binding
- S140 (= S143) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y156) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K160) binding
- 183:191 (vs. 186:194, 56% identical) binding
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
34% identity, 96% coverage: 9:246/248 of query aligns to 4:236/244 of 1nfqA
- active site: G17 (= G22), S139 (= S143), Y152 (= Y156), K156 (= K160)
- binding Androsterone: L91 (≠ D95), E141 (≠ S145), C149 (≠ L153), Y152 (= Y156), V193 (≠ T199), I197 (≠ E203), F198 (≠ A204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ S21), G17 (= G22), M18 (≠ I23), D37 (= D42), L39 (≠ A44), L59 (≠ C67), D60 (= D68), V61 (≠ L69), N87 (= N91), A88 (= A92), I137 (≠ F141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (= V189), T187 (= T191), P188 (≠ K192), M189 (≠ R193), T190 (≠ Q194)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
34% identity, 96% coverage: 9:246/248 of query aligns to 4:236/244 of 1nffA
- active site: G17 (= G22), S139 (= S143), Y152 (= Y156), K156 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), R16 (≠ S21), G17 (= G22), M18 (≠ I23), D37 (= D42), I38 (= I43), L39 (≠ A44), L59 (≠ C67), D60 (= D68), V61 (≠ L69), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ N94), I137 (≠ F141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (= V189), T187 (= T191), P188 (≠ K192), M189 (≠ R193), T190 (≠ Q194)
Q9L9F8 Short-chain reductase protein NovJ; Novobiocin biosynthesis protein J; EC 1.1.1.- from Streptomyces niveus (Streptomyces spheroides) (see paper)
34% identity, 94% coverage: 15:246/248 of query aligns to 20:260/262 of Q9L9F8
- S152 (= S143) mutation to A: 2-3-fold decrease in beta-ketotyrosine product formation.
- Y164 (= Y156) mutation to F: 50-fold reduction in catalytic activity.
- K168 (= K160) mutation to I: Does not alter the catalytic turnover.
Query Sequence
>CCNA_00864 FitnessBrowser__Caulo:CCNA_00864
MSSAIYPSLKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPI
PPVYKRCDLMNLEAIKAVFAEIGDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHML
FCTQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIR
VTCVVPGNVKTKRQEKWYTPEGEAQIVAAQCLKGRIVPENVAALVLFLASDDASLCTGHE
YWIDAGWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory