Comparing CCNA_00871 FitnessBrowser__Caulo:CCNA_00871 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 95% coverage: 7:276/283 of query aligns to 37:301/307 of Q94JV5
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
34% identity, 96% coverage: 7:279/283 of query aligns to 4:266/276 of Q9NQR4
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
34% identity, 96% coverage: 8:278/283 of query aligns to 4:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
34% identity, 96% coverage: 8:278/283 of query aligns to 4:299/304 of 4hg3A
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 96% coverage: 8:278/283 of query aligns to 7:302/307 of P47016
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
34% identity, 96% coverage: 8:278/283 of query aligns to 3:295/299 of 4hgdA
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
30% identity, 84% coverage: 30:268/283 of query aligns to 25:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
30% identity, 84% coverage: 30:268/283 of query aligns to 25:243/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
30% identity, 84% coverage: 30:268/283 of query aligns to 26:244/262 of Q9UYV8
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
29% identity, 96% coverage: 7:278/283 of query aligns to 9:263/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
29% identity, 96% coverage: 7:278/283 of query aligns to 3:257/263 of 7ovgA
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
27% identity, 88% coverage: 30:278/283 of query aligns to 32:284/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 88% coverage: 30:278/283 of query aligns to 28:280/297 of 5h8jB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
27% identity, 88% coverage: 30:278/283 of query aligns to 29:281/298 of 5h8lB
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
29% identity, 92% coverage: 19:278/283 of query aligns to 20:293/304 of Q44185
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
29% identity, 88% coverage: 30:278/283 of query aligns to 30:292/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
29% identity, 88% coverage: 30:278/283 of query aligns to 30:292/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
29% identity, 88% coverage: 30:278/283 of query aligns to 30:292/303 of 1uf5A
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
29% identity, 88% coverage: 30:278/283 of query aligns to 30:292/303 of 8hpcC
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
35% identity, 56% coverage: 108:265/283 of query aligns to 109:249/263 of 4iztA
>CCNA_00871 FitnessBrowser__Caulo:CCNA_00871
MSPPAPLRVGLIQTRTPATHAAALGHVAPLVREAIAGGAKVVLTPECTNVVQKDRSLLLP
ALKTLDEDPVVLGLREIAAQTGTWIAIGSALVRRETGDKAANRQVVIDPTGAIVATYDKL
HMFDVDLPPRDGKAGETARESSAYEPGDAAVVVDTPWAKLGLTICYDMRFPALHRALALA
GATVLTVPAAFTRPTGEAHWEILLRARAIETGSFVLAAAQGGFHEDGRGTWGRSIVVGPW
GEIIATLDHDEPGVLLADLDLPAADKARAAIPALKNARAFTGP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory